DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and Klkb1

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_036857.2 Gene:Klkb1 / 25048 RGDID:67382 Length:638 Species:Rattus norvegicus


Alignment Length:262 Identity:75/262 - (28%)
Similarity:114/262 - (43%) Gaps:48/262 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TNAKLTWWNYFDSSTDIQANPWIVSV---IVNGKAKCSGSLINHRFVLTAAHCVFREAMQVHLGD 98
            ||:.|..|            ||.||:   :|:....|.||:|..:::||||||            
  Rat   395 TNSSLGEW------------PWQVSLQVKLVSQNHMCGGSIIGRQWILTAAHC------------ 435

  Fly    99 F------DAWNPGQNCSSGARLSN-AYCVRIDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFV 156
            |      |.|.......:.:.::| .....|.:.|:|..: |:....|||.|:::|..:.|::|.
  Rat   436 FDGIPYPDVWRIYGGILNLSEITNKTPFSSIKELIIHQKY-KMSEGSYDIALIKLQTPLNYTEFQ 499

  Fly   157 RPICLLINEPVAAI-DRFQLTVWGTTAEDFRSIPRVLKHSVGDRIDRELCTLKFQQQVDESQ-IC 219
            :||||........| ....:|.||.|.|...: ..:|:.:....:..|.|..|::..|...| ||
  Rat   500 KPICLPSKADTNTIYTNCWVTGWGYTKERGET-QNILQKATIPLVPNEECQKKYRDYVITKQMIC 563

  Fly   220 VHTETS--HACKGDSGGPFSAKILYGGTYRTFQFGIIIFGLSSCAGL---SVCTNVTFYMDWIWD 279
            ...:..  .|||||||||...|  :.|.::.  .||..:| ..||..   .|.|.|..|:|||.:
  Rat   564 AGYKEGGIDACKGDSGGPLVCK--HSGRWQL--VGITSWG-EGCARKEQPGVYTKVAEYIDWILE 623

  Fly   280 AL 281
            .:
  Rat   624 KI 625

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 69/236 (29%)
Tryp_SPc 57..277 CDD:238113 69/236 (29%)
Klkb1NP_036857.2 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 201..284 CDD:128519
APPLE 292..375 CDD:128519
Tryp_SPc 390..621 CDD:214473 73/256 (29%)
Tryp_SPc 391..621 CDD:238113 73/256 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.