DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and F9

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_113728.1 Gene:F9 / 24946 RGDID:2589 Length:462 Species:Rattus norvegicus


Alignment Length:244 Identity:65/244 - (26%)
Similarity:102/244 - (41%) Gaps:51/244 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PWIVSVIVNG--KAKCSGSLINHRFVLTAAHCVFREAMQVHLGDFDAWNPGQNCSSGARLSNAYC 119
            ||  .||:||  :|.|.|::||.::::|||||:               .||......|...|   
  Rat   240 PW--QVILNGEIEAFCGGAIINEKWIVTAAHCL---------------KPGDKIEVVAGEHN--- 284

  Fly   120 VRIDKK------------IVHAGF-GKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAID 171
              ||:|            |.|..: ..|....:||.||.:...:..:.:|.|||:...|......
  Rat   285 --IDEKEDTEQRRNVIRTIPHHQYNATINKYSHDIALLELDKPLILNSYVTPICVANKEYTNIFL 347

  Fly   172 RF---QLTVWGTTAEDFRSIPRVLKHSVGDRIDRELCTLKFQQQVDESQICV--HTETSHACKGD 231
            :|   .::.||......|. ..:|::.....:||..|....:..:..:..|.  ......:|:||
  Rat   348 KFGSGYVSGWGKVFNKGRQ-ASILQYLRVPLVDRATCLRSTKFSIYNNMFCAGYREGGKDSCEGD 411

  Fly   232 SGGPFSAKILYGGTYRTFQFGIIIFGLSSCA---GLSVCTNVTFYMDWI 277
            ||||...::  .||  :|..|||.:| ..||   ...:.|.|:.|::||
  Rat   412 SGGPHVTEV--EGT--SFLTGIISWG-EECAMKGKYGIYTKVSRYVNWI 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 63/242 (26%)
Tryp_SPc 57..277 CDD:238113 63/242 (26%)
F9NP_113728.1 GLA 21..85 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 127..163 CDD:291342
Tryp_SPc 227..455 CDD:214473 63/242 (26%)
Tryp_SPc 228..458 CDD:238113 65/244 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.