DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG30289

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:288 Identity:114/288 - (39%)
Similarity:164/288 - (56%) Gaps:21/288 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KVIAALLILFASLFLGSREGSAFLLDAECGRS-----LPTNAKLTWWNYF-DSSTDIQANPWIVS 61
            :||.|::.....||:.:....:.||...||.|     :|        |.| .:.|:||.|||:  
  Fly     2 EVINAVIAALVCLFIANNNVMSRLLVENCGISKDDPYVP--------NIFGGAKTNIQENPWM-- 56

  Fly    62 VIVNGKAKCSGSLINHRFVLTAAHCVFREAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKI 126
            |:|.....|.||||..:|||||||||..|.:.|.|||::..:|...|.:...:...|.:.:|.||
  Fly    57 VLVWSSKPCGGSLIARQFVLTAAHCVSFEDLYVRLGDYETLDPMPYCLNNHCIPKFYNISVDMKI 121

  Fly   127 VHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAIDRFQLTVWGTTAEDFRSIPRV 191
            ||..:..|..|. ||.||||..||:|||:|||||||:.|.:.:|..|.:|.||.|  ::....|:
  Fly   122 VHENYNGITLQN-DIALLRMSEAVEYSDYVRPICLLVGEQMQSIPMFTVTGWGET--EYGQFSRI 183

  Fly   192 LKHSVGDRIDRELCTLKFQQQVDESQICVHTETSHACKGDSGGPFSAKILYGGTYRTFQFGIIIF 256
            |.::....:|...|.:||.:|.|.||||..:.||:.||||||||.|:|..||....:||:|::.:
  Fly   184 LLNATLYNMDISYCNIKFNKQADRSQICAGSHTSNTCKGDSGGPLSSKFHYGNRLLSFQYGLVSY 248

  Fly   257 GLSSCAG--LSVCTNVTFYMDWIWDALV 282
            |...||.  ..|.|||:::.:||::.:|
  Fly   249 GSERCAANVAGVYTNVSYHREWIFNKMV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 94/221 (43%)
Tryp_SPc 57..277 CDD:238113 94/221 (43%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 99/233 (42%)
Tryp_SPc 42..271 CDD:238113 99/233 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472856
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.