DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG30288

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:295 Identity:118/295 - (40%)
Similarity:161/295 - (54%) Gaps:42/295 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LILFASLFLG-SREGSAFLLDAECGRSLPTNAKLTWWNYFDSSTD--IQANPWIVSVIVNGKAKC 70
            |::.|.||:| .|..|..||:.:||    |.:...:....|...|  :::|||:|.|:::|||.|
  Fly     8 LVIVACLFIGIIRTESGRLLENDCG----TTSSNGYRARIDGGRDAGMESNPWMVRVMISGKAVC 68

  Fly    71 SGSLINHRFVLTAAHCVFREAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAGFGKIQ 135
            .||||..||||||.||:....|.|.||::|..:|..:|........||.|.:|:||||:..|   
  Fly    69 GGSLITARFVLTAEHCISPMYMNVRLGEYDTRHPIFDCDDFVCTPRAYNVDVDRKIVHSNPG--- 130

  Fly   136 AQQYDIGLLRMQHAVQYSDFVRPICLLINEPVA----AIDRFQLTVWGTTAEDFRSIPRVLKHSV 196
               |||||||||.:|.:|::||||||::.:.:.    :|.||..|.|||.::             
  Fly   131 ---YDIGLLRMQRSVIFSNYVRPICLILGKTLGGNPLSILRFNFTGWGTNSD------------- 179

  Fly   197 GDRIDRELCTLKFQQ-----------QVDESQICVHTETSHACKGDSGGPFSAKILYGGTYRTFQ 250
            |:..|| |.|...||           .:|.|.||..:..|.:||||||||.||...:.|..|.||
  Fly   180 GEEQDR-LQTATLQQLPQWSCERPGRPLDISYICAGSYISDSCKGDSGGPLSAIRTFEGQGRVFQ 243

  Fly   251 FGIIIFGLSSCAGLSVCTNVTFYMDWIWDALVNLS 285
            ||:...||..|:||.:.||||.:.|||.|.:.|.|
  Fly   244 FGVASQGLRLCSGLGIYTNVTHFTDWILDVIQNHS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 98/234 (42%)
Tryp_SPc 57..277 CDD:238113 98/234 (42%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 101/247 (41%)
Tryp_SPc 45..270 CDD:238113 100/244 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472862
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25741
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.