DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG30286

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:278 Identity:87/278 - (31%)
Similarity:139/278 - (50%) Gaps:14/278 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LILFASLFLGSREGSAFLLDAECGRSLPTNAKLTWWNYFDSSTDIQANPWIVSVIVNGKAKCSGS 73
            ::|..||.......:|..|:.:||...|...:..     :....|..:||:..:..:|:..|.|:
  Fly     4 ILLLTSLLPWHPHATAQFLEPDCGYMSPEALQNE-----EHQAHISESPWMAYLHKSGELVCGGT 63

  Fly    74 LINHRFVLTAAHCVFR-EAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAGFGKIQAQ 137
            |:||||:||||||:.. |.:.|.||:|::.. ..:|:....|..:....||....|.|:.:.. :
  Fly    64 LVNHRFILTAAHCIREDENLTVRLGEFNSLT-SIDCNGSDCLPPSEDFEIDVAFRHGGYSRTN-R 126

  Fly   138 QYDIGLLRMQHAVQYSDFVRPICLLIN---EP-VAAIDRFQLTVWGTTAEDFRSIPRVLKHSVGD 198
            .:||||||:..:|:|...::||||:.|   :| :..:.|...|.||.:..:  :...:||.....
  Fly   127 IHDIGLLRLAKSVEYKVHIKPICLITNTTLQPKIERLHRLVATGWGRSPSE--AANHILKSIRVT 189

  Fly   199 RIDRELCTLKFQQQVDESQICVHTETSHACKGDSGGPFSAKILYGGTYRTFQFGIIIFGLSSCAG 263
            |::..:|:..:.......||||..|:..:|.||||||....|...|.....|.||:.:|.:.|..
  Fly   190 RVNWGVCSKTYWVDRRRDQICVSHESGVSCSGDSGGPMGQAIRLDGRVLFVQVGIVSYGNAECLS 254

  Fly   264 LSVCTNVTFYMDWIWDAL 281
            .||.|||..::|||..||
  Fly   255 PSVFTNVMEHIDWIMAAL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 74/224 (33%)
Tryp_SPc 57..277 CDD:238113 74/224 (33%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 76/233 (33%)
Tryp_SPc 39..268 CDD:214473 75/232 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25741
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.