DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG30098

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:290 Identity:86/290 - (29%)
Similarity:131/290 - (45%) Gaps:51/290 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLILFASLFLGSREGSAFLLDAEC----------GRSLPTNAKLTWWNYFDSSTDIQANPWIVSV 62
            ||.....|.||| .|.:.|||::|          |:    ||:.|              ||:..:
  Fly     7 LLTFLVILTLGS-YGYSQLLDSKCIALFRIRVIGGQ----NARRT--------------PWMAYL 52

  Fly    63 IVNGKAKCSGSLINHRFVLTAAHCV-FREAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKI 126
            |.:.:..|.||||.:|||||||||. ..:.:.|.||::|:.......:...|:.:.|        
  Fly    53 IRDNRFACGGSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQTRSYRVVSIY-------- 109

  Fly   127 VHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVA----AIDRFQLTVWGTTAEDFRS 187
            .|..:  |..:.:||.:|::...|.|..::||||:|:|..:.    :|..|.||.||..|..:: 
  Fly   110 RHKNY--IDFRNHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYK- 171

  Fly   188 IPRVLKHSVGDRIDRELCTLKFQQQVDESQICVHTETSHACKGDSGGPFSAKILYGGTYRTFQFG 252
            :|..|:.....|:..|.|      .|....||......:||.||||||..:.:.||......|||
  Fly   172 MPTTLQEMSLRRVRNEYC------GVPSLSICCWNPVQYACFGDSGGPLGSLVKYGHKTIYVQFG 230

  Fly   253 IIIFGLSSCAGLSVCTNVTFYMDWIWDALV 282
            :......:|.|.|...::..||.|::..|:
  Fly   231 VTNSVTGNCDGYSSYLDLMSYMPWLYQTLL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 69/224 (31%)
Tryp_SPc 57..277 CDD:238113 69/224 (31%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 73/252 (29%)
Tryp_SPc 37..258 CDD:238113 74/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.