DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG30087

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:286 Identity:86/286 - (30%)
Similarity:136/286 - (47%) Gaps:18/286 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KVIAALLILFASLFLGSREGSAFLLDAECGRSLPTNAKLTWWNYFDSSTDIQANPWIVSVIVNGK 67
            |...|..::...|....|...|..|:..||.:..:...:...|  .....|::.|::|.|..|..
  Fly     2 KTSPAWFVIAICLIRQQRIVDAQFLNPLCGVTYESQTAMRVVN--GKEAVIRSAPFMVYVTNNSL 64

  Fly    68 AKCSGSLINHRFVLTAAHCVFREAMQVHLGDF----DAWNPGQNCSSGARLSNAYCVRIDKKIVH 128
            ..|.||::|.|::||||||||.. :::.||:.    |....|.|||.   .|..|  .|.|.|.|
  Fly    65 THCGGSILNSRYILTAAHCVFPN-LRLRLGEHNIRTDPDCQGSNCSP---RSEEY--GIMKAITH 123

  Fly   129 AGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAA--IDRFQLTVWGTTAEDFRSIPRV 191
            . |........||.||::..::.::..::|||:|:| |.:|  :..:|...||.|.::  ..|.:
  Fly   124 R-FYNAANHVNDIALLKLNRSINFNVHIQPICILLN-PASAPSVATYQTFGWGETKKN--GFPHL 184

  Fly   192 LKHSVGDRIDRELCTLKFQQQVDESQICVHTETSHACKGDSGGPFSAKILYGGTYRTFQFGIIIF 256
            |:.:.....|...|:..|...::.:|||...|....|.||||||...::.:.|..|..|.||:.:
  Fly   185 LQTAELRAYDAAYCSRSFHAYMNGNQICAGHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSY 249

  Fly   257 GLSSCAGLSVCTNVTFYMDWIWDALV 282
            |.:.|....|.|.|..|::||..|::
  Fly   250 GPTDCQSPGVYTYVPNYINWIRRAML 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 73/225 (32%)
Tryp_SPc 57..277 CDD:238113 73/225 (32%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 75/240 (31%)
Tryp_SPc 42..272 CDD:238113 77/241 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25741
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.