DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG30083

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:286 Identity:84/286 - (29%)
Similarity:124/286 - (43%) Gaps:49/286 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLILFASLFLGSREGSAFLLDAECGRSLPTNAKLTWWNYFDSSTDIQ--------ANPWIVSVI- 63
            :..:|..:.|.....|.| |:..||             |.|.|..|.        .|||:..:. 
  Fly     3 IFTIFKIILLWPGAMSQF-LEPNCG-------------YPDISPKIMHGQNAENGTNPWMAYIFK 53

  Fly    64 VNGK----AKCSGSLINHRFVLTAAHCVFR-EAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRID 123
            .|.|    ..|.|:||:.:|||:||||:.| :.:.|.||:..:             |..:.|   
  Fly    54 YNDKEVAELVCGGTLIHKQFVLSAAHCIKRDQILAVRLGEHSS-------------SRYFAV--- 102

  Fly   124 KKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEP--VAAIDRFQLTVWGTTAEDFR 186
            .|.....:....:...|||:||:|..|:::..:|||| :|.:|  |..:..|:...||.|..:  
  Fly   103 TKAFRNKYFTTGSYSNDIGILRIQPIVKFNAVIRPIC-IITDPTKVPNVKTFKAAGWGKTENE-- 164

  Fly   187 SIPRVLKHSVGDRIDRELCTLKFQQQVDESQICVHTETSHACKGDSGGPFSAKILYGGTYRTFQF 251
            :..:|||....:.::...|.......|.|||||........|.||||||....:...|:.|..|.
  Fly   165 TFSKVLKTVELNELNASECYNMLWVNVTESQICAGHPDGDTCAGDSGGPLIHPVYMDGSLRYVQL 229

  Fly   252 GIIIFGLSSCAGLSVCTNVTFYMDWI 277
            |||.||.|.|....|.|.::.::|||
  Fly   230 GIISFGSSLCNSPGVYTRLSSFIDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 70/227 (31%)
Tryp_SPc 57..277 CDD:238113 70/227 (31%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 72/240 (30%)
Tryp_SPc 34..255 CDD:238113 72/239 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25741
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.