DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG30031

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster


Alignment Length:240 Identity:62/240 - (25%)
Similarity:105/240 - (43%) Gaps:36/240 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SSTDIQANPWIVSVIVNGKAKCSGSLINHRFVLTAAHC---VFREAMQVHLGDFDAWNPGQNCSS 110
            |:|.|.:.||.:|:..:|...|.||:.:...::|||||   |....:|:..|. ..|:.|....|
  Fly    35 SATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGS-SYWSSGGVTFS 98

  Fly   111 GARLSNAYCVRIDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPV--AAIDRF 173
            .:...|           |.|: .......||.::::..|:.:|..::.|.|..:.|.  ||.   
  Fly    99 VSSFKN-----------HEGY-NANTMVNDIAIIKINGALTFSSTIKAIGLASSNPANGAAA--- 148

  Fly   174 QLTVWGTTAEDFRSIPRVLKHSVGDRIDRELC---TLKFQQQVDESQICVHTETSHACKGDSGGP 235
            .::.|||.:....|||..|::...:.:.:..|   |..:..|:..:.||.......||:||||||
  Fly   149 SVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAASGKDACQGDSGGP 213

  Fly   236 FSAKILYGGTYRTFQFGIIIFGLSSCAGLS---VCTNVTFYMDWI 277
                ::.||..    .|::.:|. .||..:   |..:|.....|:
  Fly   214 ----LVSGGVL----VGVVSWGY-GCAYSNYPGVYADVAALRSWV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 58/230 (25%)
Tryp_SPc 57..277 CDD:238113 58/230 (25%)
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 61/238 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.