DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and Mst1

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_038936729.1 Gene:Mst1 / 24566 RGDID:3114 Length:747 Species:Rattus norvegicus


Alignment Length:274 Identity:70/274 - (25%)
Similarity:116/274 - (42%) Gaps:66/274 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ECGRSLPTNAKLTWWNYFDSSTDIQA-------NPWIVSV-IVNGKAKCSGSLINHRFVLTAAHC 86
            :||:.:            |.|..::.       :||.||: ...|:..|.|||:..::||||..|
  Rat   507 KCGKRV------------DQSNRLRVVGGHPGNSPWTVSLRNRQGQHFCGGSLVKEQWVLTARQC 559

  Fly    87 VFREAMQVH--LGDFDAW--NPGQNCSSGARLSNAYCVRIDKKIVHAGFGKIQAQQYDIGLLRMQ 147
            ::    ..|  |..::.|  ...||...|.  :|...|.:.|.:.    |...:|   :.||:::
  Rat   560 IW----SCHDPLTGYEVWLGTINQNPQPGE--ANLQRVSVAKTVC----GPAGSQ---LVLLKLE 611

  Fly   148 HAVQYSDFVRPICLLINEPVAAI-DRFQLTVWGTTAEDFRS-IPRVLKHSVGDRIDRELCTLKFQ 210
            ..|..:..|..|||...:.|... ...::..||.:.....| :..|.|..|   |..:.|.:|::
  Rat   612 RPVILNHHVARICLPPEQYVVPPGTNCEIAGWGESKGTSNSTVLHVAKMKV---ISSQECNVKYR 673

  Fly   211 QQVDESQICVHTE----TSHACKGDSGGPFSAK-----ILYGGTYRTFQFGIIIFGLSSCA---G 263
            ::|.||:||  ||    .:.||:||.|||.:..     :|.|          :|.....||   .
  Rat   674 RRVQESEIC--TEGLLAPTGACEGDYGGPLACYTHDCWVLQG----------LIIPNRVCARPRW 726

  Fly   264 LSVCTNVTFYMDWI 277
            .::.|.|:.::|||
  Rat   727 PAIFTRVSVFVDWI 740

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 64/238 (27%)
Tryp_SPc 57..277 CDD:238113 64/238 (27%)
Mst1XP_038936729.1 PAN_1 32..111 CDD:394981
KR 116..196 CDD:214527
KR 199..276 CDD:214527
KR 321..403 CDD:214527
KR 408..490 CDD:214527
Tryp_SPc 520..743 CDD:238113 66/249 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336739
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.