DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and Hgf

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_058713.1 Gene:Hgf / 24446 RGDID:2794 Length:728 Species:Rattus norvegicus


Alignment Length:245 Identity:62/245 - (25%)
Similarity:97/245 - (39%) Gaps:58/245 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 WIVSVIVNGKAKCSGSLINHRFVLTAAHCVFREAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRI 122
            |:||:....|..|.||||...:||||..|.  .|....|.|::||....:............:.|
  Rat   508 WMVSLKYRNKHICGGSLIKESWVLTARQCF--PARNKDLKDYEAWLGIHDVHERGEEKRKQILNI 570

  Fly   123 DKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPI------CLLINEPVAAIDRFQLTVWGTT 181
             .::|:...|.      |:.||::.......:||..|      |.:..:...:|     ..||.|
  Rat   571 -SQLVYGPEGS------DLVLLKLARPAILDNFVSTIDLPSYGCTIPEKTTCSI-----YGWGYT 623

  Fly   182 ----AEDFRSIPRVLKHSVGDRIDRELCTLKFQQQV--DESQICVHTET--SHACKGDSGGPFSA 238
                |:....:..:  :.:|:    |.|:...|.:|  :||::|...|.  |..|:||.|||...
  Rat   624 GLINADGLLRVAHL--YIMGN----EKCSQHHQGKVTLNESELCAGAEKIGSGPCEGDYGGPLIC 682

  Fly   239 K------ILYGGTYRTFQFGIIIFGLSSCA-----GLSVCTNVTFYMDWI 277
            :      :|          |:|:.| ..||     |:.|  .|.:|..||
  Rat   683 EQHKMRMVL----------GVIVPG-RGCAIPNRPGIFV--RVAYYAKWI 719

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 60/243 (25%)
Tryp_SPc 57..277 CDD:238113 60/243 (25%)
HgfNP_058713.1 PAN_APPLE 41..123 CDD:238074
KR 127..209 CDD:214527
KR 211..289 CDD:214527
KR 305..385 CDD:214527
KR 389..471 CDD:238056
Tryp_SPc 495..719 CDD:214473 60/243 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336717
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.