DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and Habp2

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001316864.1 Gene:Habp2 / 226243 MGIID:1196378 Length:554 Species:Mus musculus


Alignment Length:269 Identity:72/269 - (26%)
Similarity:124/269 - (46%) Gaps:41/269 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CGRS-LPTNAKLTWWNYFDSSTDIQANPWIVSV---------IVNGKAKCSGSLINHRFVLTAAH 85
            ||:: :..:|....:..|.|:..  .:||.||:         :..|.. |.|:||:..:||||||
Mouse   295 CGKTEVAEHAVKRIYGGFKSTAG--KHPWQVSLQTSLPLTTSMPQGHF-CGGALIHPCWVLTAAH 356

  Fly    86 C--VFREAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAGFG-KIQAQQYDIGLLRMQ 147
            |  :..:.::|.|||.|.....         |:....|::|.:.::.:. :.:....||.||:::
Mouse   357 CTDINTKHLKVVLGDQDLKKTE---------SHEQTFRVEKILKYSQYNERDEIPHNDIALLKLK 412

  Fly   148 ----HAVQYSDFVRPICLLINEPVAAIDRFQLTVWGTTAEDFRSIPRVLKHSVGDRIDRELCTLK 208
                |....|.:|:.:| |.::|..:.....::.||.|.....|  |.|..:....|...||..:
Mouse   413 PVGGHCALESRYVKTVC-LPSDPFPSGTECHISGWGVTETGEGS--RQLLDAKVKLIANPLCNSR 474

  Fly   209 --FQQQVDESQIC---VHTETSHACKGDSGGPFSAKILYGGTYRTFQFGIIIFGLSSCAGLSVCT 268
              :...:|:|.||   :....|..|:||||||.:.:  ..|||  :.:||:.:|........|.|
Mouse   475 QLYDHTIDDSMICAGNLQKPGSDTCQGDSGGPLTCE--KDGTY--YVYGIVSWGQECGKKPGVYT 535

  Fly   269 NVTFYMDWI 277
            .||.:::||
Mouse   536 QVTKFLNWI 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 65/240 (27%)
Tryp_SPc 57..277 CDD:238113 65/240 (27%)
Habp2NP_001316864.1 EGF_CA 67..103 CDD:238011
EGF_CA 150..182 CDD:238011
KR 187..271 CDD:238056
Tryp_SPc 308..547 CDD:238113 69/256 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833196
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.