DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and PRSS54

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001073961.1 Gene:PRSS54 / 221191 HGNCID:26336 Length:395 Species:Homo sapiens


Alignment Length:318 Identity:69/318 - (21%)
Similarity:127/318 - (39%) Gaps:75/318 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKKVIAALL-ILFASLFLGSREGSAFL-LDAECGRSLPTNAKLTWWNYFDSSTDIQANPWIVSVI 63
            |:.|:..|| :|::|...|.::.|.|. .|.:.|              ..||.:.   ||:||:.
Human    13 MRGVLLVLLGLLYSSTSCGVQKASVFYGPDPKEG--------------LVSSMEF---PWVVSLQ 60

  Fly    64 VNGKAKCS-GSLINHRFVLTAAHCVFREAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIV 127
            .:.....: |.:::..:||:.|..:......|.:......:|.:...:.        ..::..|:
Human    61 DSQYTHLAFGCILSEFWVLSIASAIQNRKDIVVIVGISNMDPSKIAHTE--------YPVNTIII 117

  Fly   128 HAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLL---INEPVAAIDRFQLTVWGTTAEDFRSIP 189
            |..|.. .:...:|.||:...|:.:.:.|:.||.|   ::.| ..:....::.|..|:    :..
Human   118 HEDFDN-NSMSNNIALLKTDTAMHFGNLVQSICFLGRMLHTP-PVLQNCWVSGWNPTS----ATG 176

  Fly   190 RVLKHSVGDRI---DRELCTLKFQQQVDESQICVHT--ETSHACKGDSGGPFSAKILYGGTYRTF 249
            ..:..||..:|   |.::|.|   .::.:::...||  ||..||.||.|.|...::.        
Human   177 NHMTMSVLRKIFVKDLDMCPL---YKLQKTECGSHTKEETKTACLGDPGSPMMCQLQ-------- 230

  Fly   250 QF------GIIIFGLSSCAGLSVCTNVTFYMDWI----------------WDALVNLS 285
            ||      |::.||..:|.||.:.|.|..|..||                |:.|::.|
Human   231 QFDLWVLRGVLNFGGETCPGLFLYTKVEDYSKWITSKAERAGPPLSSLHHWEKLISFS 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 51/234 (22%)
Tryp_SPc 57..277 CDD:238113 51/234 (22%)
PRSS54NP_001073961.1 Tryp_SPc 52..264 CDD:214473 51/239 (21%)
Tryp_SPc 52..264 CDD:238113 51/239 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.