DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and Tmprss13

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_006510195.1 Gene:Tmprss13 / 214531 MGIID:2682935 Length:561 Species:Mus musculus


Alignment Length:235 Identity:62/235 - (26%)
Similarity:100/235 - (42%) Gaps:30/235 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PWIVSVIVNGKAKCSGSLINHRFVLTAAHCVF--REAMQVHLGDFDAWNPGQNCSSGARLSNAYC 119
            ||.||:.......|.|:||:.::|||||||.|  ||.:      .:.|......|:..:|..|  
Mouse   332 PWQVSLHFGTTHICGGTLIDAQWVLTAAHCFFVTREKL------LEGWKVYAGTSNLHQLPEA-- 388

  Fly   120 VRIDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAIDRFQLTVW----GT 180
            ..|.:.|::..:...| ..|||.|:|:...:..|..:.|.||.::.....::.   |.|    |.
Mouse   389 ASISQIIINGNYTDEQ-DDYDIALIRLSKPLTLSAHIHPACLPMHGQTFGLNE---TCWITGFGK 449

  Fly   181 TAEDFRSIPRVLKHSVGDRIDRELCT--LKFQQQVDESQICVHTETS--HACKGDSGGPFSAKIL 241
            |.|........|:....:.||.:.|.  |.:...:....:|......  .:|:||||||    ::
Mouse   450 TKETDEKTSPFLREVQVNLIDFKKCNDYLVYDSYLTPRMMCAGDLRGGRDSCQGDSGGP----LV 510

  Fly   242 YGGTYRTFQFGIIIFGLSSCAGLS---VCTNVTFYMDWIW 278
            .....|.:..|:..:| :.|...:   |.|.||..:.||:
Mouse   511 CEQNNRWYLAGVTSWG-TGCGQKNKPGVYTKVTEVLPWIY 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 60/232 (26%)
Tryp_SPc 57..277 CDD:238113 60/232 (26%)
Tmprss13XP_006510195.1 PHA03378 <6..>122 CDD:223065
LDLa <204..220 CDD:238060
SRCR_2 225..314 CDD:373897
Tryp_SPc 319..548 CDD:214473 60/232 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.