DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and Mst1

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_032269.3 Gene:Mst1 / 15235 MGIID:96080 Length:716 Species:Mus musculus


Alignment Length:276 Identity:61/276 - (22%)
Similarity:107/276 - (38%) Gaps:70/276 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ECGRSLPTNAKLTWWNYFDSSTDIQA-------NPWIVSV-IVNGKAKCSGSLINHRFVLTAAHC 86
            :||:.:            |.|..::.       :||.||: ...|:..|.|||:..::||||..|
Mouse   476 KCGKRV------------DKSNKLRVVGGHPGNSPWTVSLRNRQGQHFCGGSLVKEQWVLTARQC 528

  Fly    87 VFREAMQVHLGDFDAW--------NPGQNCSSGARLSNAYCVRIDKKIVHAGFGKIQAQQYDIGL 143
            ::  :....|..::.|        .||:.......::.|.|.....::|               |
Mouse   529 IW--SCHEPLTGYEVWLGTINQNPQPGEANLQRVPVAKAVCGPAGSQLV---------------L 576

  Fly   144 LRMQHAVQYSDFVRPICLLINEPVAAI-DRFQLTVWGTTAEDFRSIPRVLKHSVG-DRIDRELCT 206
            |:::..|..:..|..|||...:.|... .:.::..||   |...:....:.|... :.|..:.|.
Mouse   577 LKLERPVILNHHVALICLPPEQYVVPPGTKCEIAGWG---ESIGTSNNTVLHVASMNVISNQECN 638

  Fly   207 LKFQQQVDESQICVH--TETSHACKGDSGGPFSAK-----ILYGGTYRTFQFGIIIFGLSSCA-- 262
            .|::..:.||:||..  .....||:||.|||.:..     :|.|          :|.....||  
Mouse   639 TKYRGHIQESEICTQGLVVPVGACEGDYGGPLACYTHDCWVLQG----------LIIPNRVCARP 693

  Fly   263 -GLSVCTNVTFYMDWI 277
             ..::.|.|:.::|||
Mouse   694 RWPAIFTRVSVFVDWI 709

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 55/240 (23%)
Tryp_SPc 57..277 CDD:238113 55/240 (23%)
Mst1NP_032269.3 PAN_1 25..96 CDD:278453
KR 108..188 CDD:214527
KR 191..269 CDD:214527
KR 291..372 CDD:214527
KR 377..459 CDD:214527
Tryp_SPc 488..709 CDD:214473 55/250 (22%)
Tryp_SPc 489..712 CDD:238113 57/251 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833176
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.