DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CTRB1

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001897.4 Gene:CTRB1 / 1504 HGNCID:2521 Length:263 Species:Homo sapiens


Alignment Length:230 Identity:64/230 - (27%)
Similarity:98/230 - (42%) Gaps:28/230 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PWIVSV-IVNGKAKCSGSLINHRFVLTAAHCVFREAMQVHLGDFDAWNPGQNCSSGARLSNAYCV 120
            ||.||: ...|...|.||||:..:|:|||||..|.:..|..|:||         .|:...|...:
Human    46 PWQVSLQDKTGFHFCGGSLISEDWVVTAAHCGVRTSDVVVAGEFD---------QGSDEENIQVL 101

  Fly   121 RIDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAIDRF------QLTVWG 179
            :|.|...:..| .|.....||.||::....::|..|..:||     .:|.|.|      ..|.||
Human   102 KIAKVFKNPKF-SILTVNNDITLLKLATPARFSQTVSAVCL-----PSADDDFPAGTLCATTGWG 160

  Fly   180 TTAEDFRSIPRVLKHSVGDRIDRELCTLKFQQQVDESQICVHTETSHACKGDSGGPFSAKILYGG 244
            .|..:....|..|:.:....:....|...:.:::.:..||.......:|.||||||...:  ..|
Human   161 KTKYNANKTPDKLQQAALPLLSNAECKKSWGRRITDVMICAGASGVSSCMGDSGGPLVCQ--KDG 223

  Fly   245 TYRTFQFGIIIFGLSSCAGLS--VCTNVTFYMDWI 277
            .:..  .||:.:|..:|:..|  |...||..:.|:
Human   224 AWTL--VGIVSWGSDTCSTSSPGVYARVTKLIPWV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 63/228 (28%)
Tryp_SPc 57..277 CDD:238113 63/228 (28%)
CTRB1NP_001897.4 Tryp_SPc 33..256 CDD:214473 63/228 (28%)
Tryp_SPc 34..259 CDD:238113 64/230 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.