DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and Gzma

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_034500.1 Gene:Gzma / 14938 MGIID:109266 Length:260 Species:Mus musculus


Alignment Length:246 Identity:54/246 - (21%)
Similarity:91/246 - (36%) Gaps:55/246 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 ANPWIVSVIVNGKAKCSGSLINHRFVLTAAHCVFREAMQVHLGDFDAWNPGQNCSSGARLSNAYC 119
            :.|::..:.::....|:|:||...:|||||||...:..:..||          ..|..:......
Mouse    39 SRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILG----------AHSINKEPEQQI 93

  Fly   120 VRIDKKIVHAGFGKIQAQQYDIGLLRMQ------------HAVQYSDFVRPICLLINEPVAAIDR 172
            :.:.|...:..:.: ..::.|:.|:|::            |..:..|.|:|           ..|
Mouse    94 LTVKKAFPYPCYDE-YTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKP-----------GTR 146

  Fly   173 FQLTVWGTTAEDFRSIPRVLKHSVG-DRIDRELCT----LKFQQQVDESQICVH--TETSHACKG 230
            .::..||....  :|.|......|. ..|||::|.    ..|...:..:.||..  .....:|.|
Mouse   147 CRVAGWGRFGN--KSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNG 209

  Fly   231 DSGGPFSAKILYGGTYRTFQFGIIIFGLSSCAGLSVCTNVTF----YMDWI 277
            |||.|    :|..|..|    ||..||...|.........||    :::||
Mouse   210 DSGSP----LLCDGILR----GITSFGGEKCGDRRWPGVYTFLSDKHLNWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 52/242 (21%)
Tryp_SPc 57..277 CDD:238113 52/242 (21%)
GzmaNP_034500.1 Tryp_SPc 28..252 CDD:214473 52/244 (21%)
Tryp_SPc 29..255 CDD:238113 54/246 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833205
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.