DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG12256

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster


Alignment Length:245 Identity:68/245 - (27%)
Similarity:101/245 - (41%) Gaps:59/245 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 NGKAK--CSGSLINHRFVLTAAHCVFREAMQVHLGDFDAWNPGQNCS-----SGARLSNAYCVRI 122
            :||.:  |.||||....||||||||                .|||.|     :|.|..|.     
  Fly    71 SGKMRHFCGGSLIAPNRVLTAAHCV----------------NGQNASRISVVAGIRDLND----- 114

  Fly   123 DKKIVHAGFGKIQAQQY------------DIGLLRMQHAVQYSD-FVRPICLLINEPVAAIDRFQ 174
                 .:|| :.|.|.|            ||.:|::....:..: .|..|.:..::.|.|.....
  Fly   115 -----SSGF-RSQVQSYEMNENYQELVTSDIAILKIDPPFELDEKRVSTIDVSGSDMVGADQEVL 173

  Fly   175 LTVWGTT----AEDFRSIPRVLKHSVGDRIDRELCTLKFQQQVDESQIC-VHTETSHACKGDSGG 234
            ||.||:.    ...|...|.||:......:....|. :...|:.:::|| :......||.|||||
  Fly   174 LTGWGSVFHFGTGPFAKYPTVLQKLDYKTLSNSKCK-ETMTQLTDTEICALERFGKGACNGDSGG 237

  Fly   235 PFSAKILYGGTYRTFQFGIIIFGLSSCAGLS--VCTNVTFYMDWIWDALV 282
            |...|  .|.:|:  |.|::.:|.:.||..:  |.|.|:.:..||.:.:|
  Fly   238 PLVMK--SGESYK--QVGVVSYGTAFCASNNPDVYTRVSMFDGWIKERMV 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 65/238 (27%)
Tryp_SPc 57..277 CDD:238113 65/238 (27%)
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 65/238 (27%)
Tryp_SPc 47..280 CDD:238113 67/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.