DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and AgaP_AGAP001924

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_321140.5 Gene:AgaP_AGAP001924 / 1281201 VectorBaseID:AGAP001924 Length:381 Species:Anopheles gambiae


Alignment Length:303 Identity:72/303 - (23%)
Similarity:116/303 - (38%) Gaps:81/303 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SLFLGSREGSAFLLDAECGRSLPTNAKLTWWNYFDSSTDIQANPWIVSVIVN-GKAK---CSGSL 74
            :|.||.|..:|       |:          |            ||..:::.. |.||   |.|::
Mosquito    36 NLILGGRNATA-------GK----------W------------PWHATLMHRAGDAKKLACGGNI 71

  Fly    75 INHRFVLTAAHCVF-------REAMQVHLG--DFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAG 130
            |:...:||||||::       .:.:.|.||  :.....|.....:..||           |:|.|
Mosquito    72 IDKHTILTAAHCLYDRHKLIALDRLVVILGRTELSVEEPWSRSYAPERL-----------ILHPG 125

  Fly   131 FGKIQAQQYDIGLLRMQHAVQYSDFVRPICL----LINEPVAAIDRFQLTVWGTTAEDFRSIPRV 191
            :.:...:. ||.::::...:..||::.|:||    |.:|.:.....|   |.|....|..|....
Mosquito   126 YKQANVKD-DIAMVKLASEITMSDYIFPVCLWPRGLGHEDITGRKGF---VVGYGLNDAGSTSNH 186

  Fly   192 LKHSVGDRIDRELC------TLKFQQQVDESQICVHTETS-HACKGDSGGPFSAKILYGGTYRTF 249
            |.......:||..|      ||  ..|:..:.:|...... ..|.|||||  ....:.|..:.. 
Mosquito   187 LLDVEVPVVDRWTCLESNRDTL--SSQLASTMLCAGARDGVGPCNGDSGG--GMFFMAGNEWHI- 246

  Fly   250 QFGIIIF-----GLSSC--AGLSVCTNVTFYMDWIWDALVNLS 285
             .||:.|     |...|  ...::.|:|..|:|||.:.|.|::
Mosquito   247 -RGIVSFAPNLDGTDKCDPKQYAIYTDVAKYLDWIANKLGNVT 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 61/250 (24%)
Tryp_SPc 57..277 CDD:238113 61/250 (24%)
AgaP_AGAP001924XP_321140.5 Tryp_SPc 38..283 CDD:238113 69/294 (23%)
Tryp_SPc 38..280 CDD:214473 67/291 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.