DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CLIPA4

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_552464.1 Gene:CLIPA4 / 1280862 VectorBaseID:AGAP011780 Length:422 Species:Anopheles gambiae


Alignment Length:270 Identity:70/270 - (25%)
Similarity:110/270 - (40%) Gaps:39/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CGRSLPTNAKLTWWNYFDSSTDIQANPWIVSVI--VNGKAKCSGSLINHRFVLTAAHCV--FREA 91
            ||.........|....|::.......||.|::|  .:|.:.|.||||:...|||.||||  ||:.
Mosquito   143 CGLRNIGGIDFTLTGNFNNEAGFGEFPWTVAIIKTQDGSSTCGGSLIHPNLVLTGAHCVQGFRKG 207

  Fly    92 -MQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDF 155
             ::|..|::|.    |..............|::.   |..|.. ::...||.:|.:...:|.::.
Mosquito   208 QLKVRAGEWDT----QTTKERLPYQERAVTRVNS---HPDFNP-RSLANDIAVLELDSPIQPAEH 264

  Fly   156 VRPICL-LINEPVAAIDRFQLTVWGTTAEDF----------RSIPRVLKHSVGDRIDREL----C 205
            :..:|| .:|......|.| .:.||  .:.|          :.:|..|..|  ...:|:|    .
Mosquito   265 INVVCLPPVNFDTRRTDCF-ASGWG--KDQFGKAGRYSVIMKKVPLPLVPS--STCERQLQATRL 324

  Fly   206 TLKFQQQVDESQICVHTETS-HACKGDSGGPFSAKILYGGTYRTFQFGIIIFGLSSC--AGLSVC 267
            |.:|  ::.::.||...|.. ..|:||.|.|....|......|..|.|.:.:|: .|  |...|.
Mosquito   325 TSRF--RLHQTFICAGGERGVDTCEGDGGAPLVCPIGAASENRYAQVGSVAWGI-GCHDAVPGVY 386

  Fly   268 TNVTFYMDWI 277
            |||..:..||
Mosquito   387 TNVILFRSWI 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 64/242 (26%)
Tryp_SPc 57..277 CDD:238113 64/242 (26%)
CLIPA4XP_552464.1 Tryp_SPc 161..399 CDD:238113 66/252 (26%)
Tryp_SPc 161..396 CDD:214473 64/250 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.