DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and AgaP_AGAP011793

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_320722.4 Gene:AgaP_AGAP011793 / 1280855 VectorBaseID:AGAP011793 Length:426 Species:Anopheles gambiae


Alignment Length:278 Identity:70/278 - (25%)
Similarity:112/278 - (40%) Gaps:75/278 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DSSTDIQANPWIVSVIVNGKA--------KCSGSLINHRFVLTAAHCVFR---EAMQVHLGDFD- 100
            |..::....||:.:::...||        .|.||||:...:|||||||..   .|::|.||::| 
Mosquito   165 DGESEYGEFPWMAAILEEQKALDQIINTYMCGGSLIHPSVILTAAHCVQNITITALKVRLGEWDT 229

  Fly   101 -AWN---PGQNCSSGARLSNAYCVRIDKKIVHAGFGK---IQAQQYDIGLLRMQHAVQYSDFVRP 158
             :|.   |.|                |:::|...|.:   ..|...::.||.:...|:..:.|..
Mosquito   230 RSWKEPFPHQ----------------DRRVVEIAFHEQFFAPAALNNVALLFLDKPVELMETVNT 278

  Fly   159 ICL----LINEPVAAIDRFQLTVWGTTAED-------FRSIPRVLKHSVGDRIDRELCTLKFQQ- 211
            |||    ...:||..:    .:.||   :|       |::|   ||......:.|..|....:. 
Mosquito   279 ICLPPANYTFDPVRCV----ASGWG---KDVFGNEGMFQAI---LKKVELPLMPRGACQRALRMT 333

  Fly   212 ------QVDESQICVHTETSH-ACKGDSGGPFSAKI--LYGGTYRTFQFGIIIFGLSSCAGL--- 264
                  ::.||.:|...|... .||||.|.|....|  :..|.|   |..|:.:|::  .|:   
Mosquito   334 RLGRRFKLHESFLCAGGEKGRDTCKGDGGSPLVCPIPGVANGYY---QASIVAWGIN--CGIEGV 393

  Fly   265 -SVCTNVTFYMDWIWDAL 281
             .|..||..:.:||.:.|
Mosquito   394 PGVYVNVALFREWIDEQL 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 66/263 (25%)
Tryp_SPc 57..277 CDD:238113 66/263 (25%)
AgaP_AGAP011793XP_320722.4 Tryp_SPc 167..410 CDD:238113 68/273 (25%)
Tryp_SPc 167..407 CDD:214473 66/270 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.