DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CLIPB11

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_319991.3 Gene:CLIPB11 / 1280172 VectorBaseID:AGAP009214 Length:359 Species:Anopheles gambiae


Alignment Length:292 Identity:87/292 - (29%)
Similarity:131/292 - (44%) Gaps:56/292 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SREGSAFLLDAE-CGR------SLPTNAKLTWWNYFDSSTDIQANPWIVSVIVN-GKAKCSGSLI 75
            :||.....||.| ||.      :...:|:|  :.|          ||:..:... |...|.|:||
Mosquito    93 NRERGLATLDLEGCGAYSEDRIAFGQDARL--FQY----------PWMALLKQRAGNFVCGGTLI 145

  Fly    76 NHRFVLTAAHCV-FREAMQVHLGDFDAWNP------GQNCSSGARLSNAYCVRIDKKIVHAGFGK 133
            |.|:|||||||: ..:...|.||:||...|      |:.|:...:     .:.:::.|||..: .
Mosquito   146 NERYVLTAAHCIKNNDITTVRLGEFDLSTPIDCDKRGEQCAPPPQ-----DLFVEQTIVHEAY-S 204

  Fly   134 IQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAIDRFQLTV-----WGTTAEDFRSIPRVLK 193
            .:.::.||||:|:....:|:|.|.||||    ||....|...|.     ||.| |...|..| |:
Mosquito   205 ARRKENDIGLVRLAKEAEYNDNVLPICL----PVTPAMRTTQTTYFVAGWGAT-ESAPSSNR-LQ 263

  Fly   194 HSVGDRIDRELCTLKFQQ-----QVDESQIC-VHTETSHACKGDSGGPFSAKILYGGTYRTFQFG 252
            .:....:..:.|..|..:     :|:..|:| :....:..|.||||||.....:   ..|..|:|
Mosquito   264 FTKLSLLSNDQCVQKLLRVDSFAKVNNDQMCAIGANLTDNCTGDSGGPLKTISI---NARYVQYG 325

  Fly   253 IIIFGLSSCAGLS---VCTNVTFYMDWIWDAL 281
            ::.:||.:|...|   |.|.|..|.|||.:.|
Mosquito   326 VVSYGLRTCGKQSAPGVYTRVENYADWILEHL 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 74/241 (31%)
Tryp_SPc 57..277 CDD:238113 74/241 (31%)
CLIPB11XP_319991.3 Tryp_SPc 113..353 CDD:214473 77/266 (29%)
Tryp_SPc 117..356 CDD:238113 79/265 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.