DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG43336

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:295 Identity:93/295 - (31%)
Similarity:137/295 - (46%) Gaps:51/295 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLILFASLFLGSREGSAFLLDAECG-----RSLP-----TNAKLTWWNYFDSSTDIQANPWIVSV 62
            ::::..:.||....||...||..||     .|:|     |.|.||            ::||:..:
  Fly     3 VVVVGLTFFLLPLLGSTQFLDMACGIRAHSPSVPRVKNGTVASLT------------SSPWMAFL 55

  Fly    63 -IVNGKAKCSGSLINHRFVLTAAHCVF-REAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKK 125
             ..:|:..|.||||.:|.|||||||.. |..:...||::|. ...:.|      .::||....:.
  Fly    56 HSTDGRFICGGSLITNRLVLTAAHCFLDRTELVARLGEYDR-EEYEMC------HDSYCTYRIEA 113

  Fly   126 IVHAGFG----KIQAQQYDIGLLRMQHAVQYSDFVRPICLLIN----EPVAAIDRFQLTVWGTTA 182
            :|..||.    ......|||.:||:...|||:|.:||||::|:    :.:.::|....|.||.|.
  Fly   114 MVERGFRHRHYNPMTMAYDIAILRLYRKVQYTDNIRPICIVIDPRWRKYIDSLDPLTGTGWGKTE 178

  Fly   183 ED-----FRSIPRVLKHSVGDRIDRELCTLKFQQQVDESQICVHTETSHACKGDSGGPFSAKILY 242
            .:     .|::....||.       |:|.......:..:|.|...|.|:.|.||||||..|.|.|
  Fly   179 SEGDSAKLRTVDLARKHP-------EVCRRYATLSLTANQFCAGNERSNLCNGDSGGPVGALIPY 236

  Fly   243 GGTYRTFQFGIIIFGLSSCAGLSVCTNVTFYMDWI 277
            |.:.|..|.||..|..:.|..:||.|:|..|:|||
  Fly   237 GKSKRFVQVGIASFTNTQCVMVSVFTDVMSYVDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 77/234 (33%)
Tryp_SPc 57..277 CDD:238113 77/234 (33%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 81/259 (31%)
Tryp_SPc 40..271 CDD:238113 81/256 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25741
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.