DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG43124

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:311 Identity:66/311 - (21%)
Similarity:109/311 - (35%) Gaps:127/311 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VIAALLILFASLFLGSREGSAFLLDAECGRSLPTNAKLTWWNYFDSSTDIQAN---PWIVSVIVN 65
            ::..::::|       .:|||..|:.:|               .|....|..:   ||:..::.:
  Fly     7 IVLCIVLMF-------YQGSAQTLEEDC---------------VDHMERINGSSYAPWLAEILSD 49

  Fly    66 GKAKCSGSLINHRFVLTAAHCVFR--EAMQVHLGD--FDA------------WN---PGQNCSSG 111
            .|..|:|:|||:.:|||||.| |:  |.:.|.||.  ||.            |.   |..|    
  Fly    50 SKVICAGALINNLYVLTAASC-FKENEKLTVRLGSGYFDKSYENFRVTKAYFWMTHFPANN---- 109

  Fly   112 ARLSNAYCVRIDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAIDRFQLT 176
               :|..|:                       .|:|..|::...:||:|:..:.....:      
  Fly   110 ---TNNLCI-----------------------FRLQTEVEFKTHIRPMCITKSPKSLGL------ 142

  Fly   177 VWGTTAEDFRSIPRV-----------LKHSVGDRIDRELCTLKFQQQVDESQICVHTETSHACKG 230
              .||.|.....|::           .|:..|:..:      |:|.:...|.   .|||.     
  Fly   143 --ATTFEIINEKPKMWYFCKNIKGLFCKYVFGENEE------KWQSKPTGSP---WTETI----- 191

  Fly   231 DSGGPFSAKILYG-GTYR---TFQFGIIIFGLSSCAGLSVCTNVTFYMDWI 277
             |.|||...:.|| .:||   |:.              .|..||..:::||
  Fly   192 -SNGPFKGLVRYGILSYRDNKTYD--------------EVYINVMSHINWI 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 56/253 (22%)
Tryp_SPc 57..277 CDD:238113 56/253 (22%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 31/122 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.