DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG43125

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:293 Identity:74/293 - (25%)
Similarity:127/293 - (43%) Gaps:74/293 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKKVIAALLILFASLFLGSREGSAFLLDAECGRSLPTNAKLTWWNYFDSSTDIQANPWIVSV--I 63
            ::..:.|||:.:        :|||..|:..||:|          :.|..:      ||:|.:  .
  Fly     5 LRLAVFALLLFY--------QGSALFLEQNCGKS----------SVFSPA------PWLVKIRPE 45

  Fly    64 VNGKAKCSGSLINHRFVLTAAHCV-FREAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIV 127
            ::....|:|:|||.|||||||.|: ::..:.|.||:.|  ...|| ||..:....|..|   .::
  Fly    46 LSSNITCTGTLINERFVLTAASCIDYQTELIVRLGEID--GTLQN-SSKLQYEEIYVAR---ALI 104

  Fly   128 HAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLIN------EPVAAIDRFQLTVWGTTAEDFR 186
            |..:.. ::.||:|.|||::.:|.|...::|||:.:|      .|...|::.:      ..|..:
  Fly   105 HRSYSS-ESHQYNIALLRLKTSVVYKKNIQPICIDVNVGKVPKAPTFEIEKKK------NEEPKK 162

  Fly   187 SIPRVLKHSV-------GDRIDRELCTLKFQQQVDESQICVHTETSHACKGDSGGPFSAKILYGG 244
            :...::|..:       |.|..|....|..|      .|.|            |.|.:.:|....
  Fly   163 NKAGIMKRFLNWFLSLFGVREPRPDVILPPQ------PIAV------------GWPLTKQINESA 209

  Fly   245 TYRTFQFGIIIFGLSSCAGLSVCTNVTFYMDWI 277
            .:.  |:||:.. .:|.:...|.|:|..|::||
  Fly   210 LFH--QYGILSH-RNSESKKDVYTDVMAYVNWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 61/235 (26%)
Tryp_SPc 57..277 CDD:238113 61/235 (26%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 37/106 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.