DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and AgaP_AGAP006539

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_316577.4 Gene:AgaP_AGAP006539 / 1277138 VectorBaseID:AGAP006539 Length:270 Species:Anopheles gambiae


Alignment Length:231 Identity:61/231 - (26%)
Similarity:99/231 - (42%) Gaps:45/231 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 GKAKCSGSLINHRFVLTAAHCV-----FREAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKK 125
            |...|.||:::..:.:||||||     :.:.:||          |:...|.....:.|  .|.:.
Mosquito    58 GGHSCGGSILSELWAMTAAHCVSSTTTYLQTIQV----------GRTNISRDVDDSVY--GIAQV 110

  Fly   126 IVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICL--LINEPVAAIDRFQLTV--WGTTAEDFR 186
            |.|..:....:...||.||::|..:.:|:.|:|:.|  .:.|....:|...:|:  ||..|.. .
Mosquito   111 IAHPQYDSRNSHLNDIALLKLQRPIVFSESVQPVRLPAPMFEVEDDLDDLGVTLIGWGLLATG-G 174

  Fly   187 SIPRVLKHSVGDRID-----RELCTLKFQQQVDESQIC--VHTETSHACKGDSGGPFSAKILYGG 244
            |.|..|:     |:|     .|.|.......:..|.||  :.......|.||||||    :|:.|
Mosquito   175 SAPATLQ-----RVDYYVVPNEECNAIHTGTIYPSHICAAIPGGGKGQCSGDSGGP----LLHHG 230

  Fly   245 TYRTFQFGIIIFGLSSCAGL---SVCTNVTFYMDWI 277
            .    |.||:.:.:..||..   .|.|.|:.::::|
Mosquito   231 V----QVGIVSWSVKPCAVAPYPGVLTKVSHHLEFI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 60/229 (26%)
Tryp_SPc 57..277 CDD:238113 60/229 (26%)
AgaP_AGAP006539XP_316577.4 Tryp_SPc 35..262 CDD:214473 60/229 (26%)
Tryp_SPc 36..265 CDD:238113 61/231 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.