DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and AgaP_AGAP010546

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_314515.4 Gene:AgaP_AGAP010546 / 1275277 VectorBaseID:AGAP010546 Length:295 Species:Anopheles gambiae


Alignment Length:215 Identity:58/215 - (26%)
Similarity:90/215 - (41%) Gaps:41/215 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 NGKAK--CSGSLINHRFVLTAAHCVFRE----AMQVHLGDFDAWN------PGQNCSSGARLSNA 117
            :||..  |.||||...|:||||||...:    .....:||.:.::      |.|           
Mosquito    87 DGKVNWGCGGSLIWENFILTAAHCAANDEDVPPDVARMGDLNIYSDDDDEFPQQ----------- 140

  Fly   118 YCVRIDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAIDRFQLTVWGTT- 181
              :||.|.|.|... :..|:.||:.|::::..:...:.|.|.||.:::.| ...:.....||.| 
Mosquito   141 --LRIVKVIRHQQH-RFSAKYYDVALMQLEKNITVHETVAPACLWLDDEV-RFPKLYAAGWGRTG 201

  Fly   182 -AEDFRSIPRVLKHSVGDRIDRELCTLKFQQQVDES--------QICVHTETSHACKGDSGGPFS 237
             .||..:|  :||..: ..::...|: ||....:..        .:|...|....|.||||||..
Mosquito   202 FGEDKTNI--LLKVDL-TPMNNTQCS-KFYTSSERGLRNGLHAHHLCAGDEKMDTCPGDSGGPLH 262

  Fly   238 AKILYGGTYRTFQFGIIIFG 257
            .|:|:......|..|:..||
Mosquito   263 VKLLHNAKMTPFLVGVTSFG 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 58/215 (27%)
Tryp_SPc 57..277 CDD:238113 58/215 (27%)
AgaP_AGAP010546XP_314515.4 Tryp_SPc 67..295 CDD:214473 58/215 (27%)
Tryp_SPc 67..295 CDD:238113 58/215 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25741
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.