DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CLIPB13

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_314336.2 Gene:CLIPB13 / 1275070 VectorBaseID:AGAP004855 Length:410 Species:Anopheles gambiae


Alignment Length:258 Identity:88/258 - (34%)
Similarity:135/258 - (52%) Gaps:37/258 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SSTDIQANPWIVSVIV--NG--KAKCSGSLINHRFVLTAAHCVFREA----MQVHLGDFD----- 100
            ::|.:...||:|.:..  ||  ..:|.|||||:|:||||||||...:    ::|.||:.|     
Mosquito   155 NTTRVFEYPWMVLLRYESNGVLSDRCGGSLINNRYVLTAAHCVRTSSSIRLVKVRLGEHDKRQQI 219

  Fly   101 ---AWNPGQ-NCSSGARLSNAYCVRIDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICL 161
               .::.|: :|:     ..|..|.|:..|||..:.:....::||.||||...|::||.|:||||
Mosquito   220 DCHVYSDGEKDCA-----DPAVDVDIESMIVHKDYNRPIKFRHDIALLRMAQEVEFSDSVKPICL 279

  Fly   162 LINEPV--AAIDRFQLTVWGTTAEDFRSIPRVLKHSVGDRIDRELCTLKFQQQ------VDESQI 218
            .:||.|  ..:.::.:|.||||.:  :|:..:|..::.:.:....|..|..:.      .||.|:
Mosquito   280 PVNEDVRRKVLPKYIITGWGTTEQ--QSLSDLLLQAIVNHVPVPECQQKMNENFLYVTLADEWQM 342

  Fly   219 CVHTE-TSHACKGDSGGPFSAKILYGGTYRTFQFGIIIFGLSSCAGLSV---CTNVTFYMDWI 277
            |...| ...:|:||||||....:...|. :..||||:..|:.||...||   .|.||.||:||
Mosquito   343 CAAGEGLVDSCQGDSGGPLGFSVDVAGA-KFVQFGIVSAGVRSCGKESVPGIYTRVTSYMNWI 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 85/248 (34%)
Tryp_SPc 57..277 CDD:238113 85/248 (34%)
CLIPB13XP_314336.2 CLIP 28..81 CDD:288855
Tryp_SPc 150..404 CDD:214473 86/256 (34%)
Tryp_SPc 151..404 CDD:238113 86/256 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.