DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and AgaP_AGAP005065

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_313940.4 Gene:AgaP_AGAP005065 / 1274748 VectorBaseID:AGAP005065 Length:246 Species:Anopheles gambiae


Alignment Length:280 Identity:71/280 - (25%)
Similarity:117/280 - (41%) Gaps:52/280 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VIAALLILFASLFLGSREGSAFLLDAECGRSLPTNAKLTWWNYF---DSSTDIQANPWIVSVIVN 65
            |:..:|:.|....|                |:|.      ||..   ..:.|.|. |:.:::...
Mosquito     8 VVGLVLVAFLGTVL----------------SVPI------WNRIVGGQLAEDTQM-PYQIALFYQ 49

  Fly    66 GKAKCSGSLINHRFVLTAAHCVFREAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAG 130
            |..:|.||:|..|.||||||||..:.:.:....|.......:.::|.:|.....|     ..|.|
Mosquito    50 GSFRCGGSIIGDRHVLTAAHCVMDDDVLLPAFKFGVHAGSAHLNAGGKLFKVRAV-----YPHEG 109

  Fly   131 FGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAIDRFQLTVWGTTAEDFRSIPRVLKHS 195
            :|..   |:||.::.|:....:..:::|| .|::|.|.......::.:|....:....|.:|..|
Mosquito   110 YGNF---QHDIAVMEMKEPFAFDKYIQPI-ELMDEEVPLGGEVVISGYGRVGSNGPVSPALLYTS 170

  Fly   196 VGDRIDRELCTLKFQQQVDESQICVHTETSH-ACKGDSGGPFSAKILYGGTYRTFQFGIIIFGLS 259
            : ..::.|.|     ..:.|..:|:..|.|: ||.||||||    .:|.|...    |:..|.:.
Mosquito   171 M-FVVEDENC-----NSISEGLMCIDKEGSYGACNGDSGGP----AVYDGKLA----GVANFIID 221

  Fly   260 SCAG--LSVCTNVTFYMDWI 277
            .|.|  ......|:||:|||
Mosquito   222 QCGGNFADGYAKVSFYLDWI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 59/222 (27%)
Tryp_SPc 57..277 CDD:238113 59/222 (27%)
AgaP_AGAP005065XP_313940.4 Tryp_SPc 28..241 CDD:214473 61/236 (26%)
Tryp_SPc 29..243 CDD:238113 63/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.