DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CLIPB2

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_312956.3 Gene:CLIPB2 / 1273920 VectorBaseID:AGAP003246 Length:355 Species:Anopheles gambiae


Alignment Length:317 Identity:95/317 - (29%)
Similarity:144/317 - (45%) Gaps:54/317 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AALLILFASLFLGSREGSAFLLDAECGR------------------SLPTN----AKLTWWNYFD 48
            |:||.:::..|. :.|.:.||..:.||.                  |.||:    .::|......
Mosquito    43 ASLLAIYSKRFT-TPEETQFLASSRCGEIGRKTLVCCASEQQTRTSSFPTSPECGIQVTDRIIGG 106

  Fly    49 SSTDIQANPWIVSVIVNGKAK-----CSGSLINHRFVLTAAHCVFR-----EAMQVHLGDFDAWN 103
            .:|:::..||...:.......     |.|:|||.|::|||||||..     :...|.||::|. :
Mosquito   107 QTTELEEFPWTALIEYRKPGNQYDFHCGGALINARYILTAAHCVQSLPRGWQLNGVRLGEWDL-S 170

  Fly   104 PGQNCSSGARLSNAYCVRIDKKIVHAGFGKIQ-AQQYDIGLLRMQHAVQYSDFVRPICLLINEPV 167
            ...:||.|...:....:.|:..:.|||:.... |...||.|:|::..|..|:.:|||||.:.||.
Mosquito   171 TANDCSDGICSAGPIDLEIESFVAHAGYDAADTAHTNDIALIRLRQDVASSEMIRPICLPLTEPQ 235

  Fly   168 AAIDRFQLTV-----WGTTAEDFRSIPRVLKHSVGDRIDRELCTLKFQQ---QVDESQICV-HTE 223
            .:.:|.. ||     ||.| |...:..|.||..:..: |...|...::.   .:..||:|. ..:
Mosquito   236 RSRNRVG-TVSFAAGWGKT-ESASASERKLKVELTVQ-DPSRCRQIYRGINIALKASQMCAGGLQ 297

  Fly   224 TSHACKGDSGGPFSAKILYGGTYRTFQFGIIIFGLSSC--AGL-SVCTNVTFYMDWI 277
            ....|.||||||..||  ..|.:  :..|::.||||.|  ||. .|.|||..|:|||
Mosquito   298 GKDTCTGDSGGPLMAK--SAGAW--YLIGVVSFGLSKCGTAGYPGVYTNVVEYLDWI 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 79/242 (33%)
Tryp_SPc 57..277 CDD:238113 79/242 (33%)
CLIPB2XP_312956.3 CLIP 26..78 CDD:288855 9/35 (26%)
Tryp_SPc 102..350 CDD:214473 80/255 (31%)
Tryp_SPc 103..353 CDD:238113 82/256 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.