DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and AgaP_AGAP002842

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_312070.5 Gene:AgaP_AGAP002842 / 1273118 VectorBaseID:AGAP002842 Length:282 Species:Anopheles gambiae


Alignment Length:239 Identity:63/239 - (26%)
Similarity:96/239 - (40%) Gaps:44/239 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 CSGSLINHRFVLTAAHC----VFREAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAG 130
            |.|:||:.|||||||||    :......|.||..|...|            |..|.:...::|.|
Mosquito    63 CGGTLISDRFVLTAAHCAHTGMSHPPTVVQLGAHDLRRP------------ALYVGVRDVVLHPG 115

  Fly   131 FGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAIDRFQLTVWGTTAEDFRSIPRVLKHS 195
            :|.:.|.. ||.|:|::..|..|  ::|..|..:|.:........|.||.... |.....:|:..
Mosquito   116 YGGVLAYN-DIALIRLESPVASS--IQPALLWRSETIPENVPLIATGWGKLGH-FEDPSMILQRV 176

  Fly   196 VGDRIDRELC------TLKFQQQVDESQICVHTET--SHACKGDSGGPFSAKI----LYGGTYRT 248
            ....:....|      :.:.:..|..||:|.....  ...|:||||||...|:    ..|..||.
Mosquito   177 QIPIVPNSQCNQLLYRSRRLRHGVLPSQLCAGDPNGGKDTCEGDSGGPLQLKLPSARPIGQAYRY 241

  Fly   249 FQFGIIIFGLSSCAGL-------SVCTNVTFYMDWIWDALVNLS 285
            :     :.|::|..|:       .:.|.|:.|..||...|..::
Mosquito   242 Y-----VVGITSNGGICGTVDRPGLYTRVSSYAGWIDQVLEQIT 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 60/229 (26%)
Tryp_SPc 57..277 CDD:238113 60/229 (26%)
AgaP_AGAP002842XP_312070.5 Tryp_SPc 26..275 CDD:238113 62/232 (27%)
Tryp_SPc 26..272 CDD:214473 60/229 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.