DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and AgaP_AGAP000290

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_310831.5 Gene:AgaP_AGAP000290 / 1271969 VectorBaseID:AGAP000290 Length:499 Species:Anopheles gambiae


Alignment Length:245 Identity:63/245 - (25%)
Similarity:108/245 - (44%) Gaps:39/245 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PWIVSV---IVNGK--AKCSGSLINHRFVLTAAHCVFREAMQ-----VHLGDFDAWNPGQNCSSG 111
            ||.|::   |.||.  ..|.|:|:|...|:||||||....:.     |:.||:|..:..:.....
Mosquito   267 PWTVAIHQLIRNGSYVYHCGGALLNQSVVVTAAHCVSNNRLHPNRFVVYAGDWDRRHTQERLPHQ 331

  Fly   112 ARLSNAYCVRIDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDF---VRPICLLINEPVAAI--D 171
            .|       .:.:.:||..:.. .|...|:.||....  .::|.   |.|:||........|  |
Mosquito   332 ER-------TVSRVLVHPNYYS-GALFNDLALLFFSE--PFNDTVANVEPVCLSSPSGTDYIPPD 386

  Fly   172 RFQLTVWGTTAEDFRSIPRVLKHSVGDRIDRELCTLKFQQ--------QVDESQICVHTETSHAC 228
            ...:|.||.:.:..|: ..:.::|....::|..|..:.|.        ::.:|.:|..|:.:..|
Mosquito   387 NCFVTGWGGSPKGNRA-QSIQQYSKLQLVERHRCETQLQSLPTLGSKFKLHQSFVCAATDGTDVC 450

  Fly   229 KGDSGGPFSAKILYGGTYRTFQFGIIIFGLSSCAGL-SVCTNVTFYMDWI 277
            :|..|.|::.:  ..|.|  :..||:.:|:....|: :|.||||...:||
Mosquito   451 QGSGGSPYACE--RDGRY--YLVGIVSWGVGCGDGIPAVLTNVTELREWI 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 61/243 (25%)
Tryp_SPc 57..277 CDD:238113 61/243 (25%)
AgaP_AGAP000290XP_310831.5 Tryp_SPc 265..499 CDD:238113 63/245 (26%)
Tryp_SPc 265..496 CDD:214473 61/243 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.