DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and AgaP_AGAP007142

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_308619.3 Gene:AgaP_AGAP007142 / 1269964 VectorBaseID:AGAP007142 Length:251 Species:Anopheles gambiae


Alignment Length:227 Identity:65/227 - (28%)
Similarity:101/227 - (44%) Gaps:39/227 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 CSGSLINHRFVLTAAHCVF--REAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAGFG 132
            |.|::|:.::|||||||..  .:.|||..|..|..:.|:...            :::..||:.|.
Mosquito    53 CGGTIIDRQWVLTAAHCAILPPKLMQVLAGTNDLRSGGKRYG------------VEQFFVHSRFN 105

  Fly   133 KIQAQQYDIGLLRMQHAVQYSDFVRPI-----CLLINEPVAAIDRFQLTVWGTTAEDFRSIPRVL 192
            |..... ||.|::::..:::.:||:.:     .|.:|..|.|      |.||..:.. .|:||:|
Mosquito   106 KPPFHN-DIALVKLKTPLEFGEFVQAVEYSERQLPVNATVRA------TGWGKVSTS-GSVPRML 162

  Fly   193 KHSVGDRIDRELC--TLKFQQQVDESQICVHT-ETSHACKGDSGGPFSAKILYGGTYRTFQFGII 254
            :......:..|.|  .|:....||...||..| |....|.||||||    ::|.|..    .|:.
Mosquito   163 QTINLRYVPYEECKRLLEDNPAVDLGHICTLTKEGEGVCNGDSGGP----LVYEGKV----VGVA 219

  Fly   255 IFGLSSCAGL-SVCTNVTFYMDWIWDALVNLS 285
            .|.:....|. ....:|::|.|||...|.|.|
Mosquito   220 NFAVPCAQGYPDGFASVSYYHDWIRTTLANNS 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 60/217 (28%)
Tryp_SPc 57..277 CDD:238113 60/217 (28%)
AgaP_AGAP007142XP_308619.3 Tryp_SPc 27..243 CDD:214473 60/217 (28%)
Tryp_SPc 28..246 CDD:238113 62/220 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.