DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CLIPA3

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_024667072.1 Gene:CLIPA3 / 1268922 VectorBaseID:AGAP012591 Length:422 Species:Anopheles gambiae


Alignment Length:294 Identity:69/294 - (23%)
Similarity:114/294 - (38%) Gaps:75/294 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ECGRSLPTNAKLTWWNYFDSSTDIQAN-------PWIVSVIVNGKAKC-SGSLINHRFVLTAAHC 86
            :||...|..|         :|..:.||       ||.|.::..|.... ||:||::..||||||.
Mosquito   165 QCGMQYPPIA---------NSPAVTANQAAYGEYPWQVVLLGPGDVYVGSGALIDNLHVLTAAHK 220

  Fly    87 VF-----REAMQVHLGDFDAWN-----PGQNCSSGARLSNAYCVRIDKKIVHAGFGKIQAQQYDI 141
            :.     ..|::|.||::||.:     |.|..:            :.:..||..|.....:. ||
Mosquito   221 ISDYTSGTRALKVRLGEWDAASTTEPLPVQEFT------------VARYFVHPSFTAANLRN-DI 272

  Fly   142 GLLRMQHAVQY--SDFVRPICLLINEPVAAIDRFQLTVWGT---TAEDFRSIPRVLKHSVGDRID 201
            .:||:...|..  :..:...||.:...|.:  |..::.||.   .:..|:|||:.:...:.:..:
Mosquito   273 AILRLSGTVALGTTPTIATACLPVTSFVGS--RCWVSGWGKNDFVSGAFQSIPKEVDVPIVNSAN 335

  Fly   202 RE-------------LCTLKFQQQVDESQICVHTET-SHACKGDSGGPFSAKILYGGTYRTFQFG 252
            .:             |.|..|        :|...|. ..||.||.|.|....:    ..|.:..|
Mosquito   336 CQTALRTTRLGGNFVLDTTSF--------LCAGGELGKDACTGDGGSPLVCAL----NNRWYVVG 388

  Fly   253 IIIFGLSSCA-GL-SVCTNVTFYMDWIWDALVNL 284
            ::.:|:...| |: .|..||..|:.||...:..:
Mosquito   389 LVAWGIGCGANGIPGVYVNVASYITWITSTIATV 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 60/251 (24%)
Tryp_SPc 57..277 CDD:238113 60/251 (24%)
CLIPA3XP_024667072.1 Tryp_SPc 182..418 CDD:238113 63/262 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.