DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CMA1

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001827.1 Gene:CMA1 / 1215 HGNCID:2097 Length:247 Species:Homo sapiens


Alignment Length:246 Identity:66/246 - (26%)
Similarity:96/246 - (39%) Gaps:77/246 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 VIVNGKAK-CSGSLINHRFVLTAAHCVFREAMQVHLG------DFDAWNPGQNCSSGARLSNAYC 119
            |..||.:| |.|.||...||||||||..| ::.|.||      :.|.|..               
Human    42 VTSNGPSKFCGGFLIRRNFVLTAAHCAGR-SITVTLGAHNITEEEDTWQK--------------- 90

  Fly   120 VRIDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYS------------DFVRP--ICLLINEPVAAI 170
            :.:.|:..|..: ......:||.||:::.....:            :||.|  :|          
Human    91 LEVIKQFRHPKY-NTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMC---------- 144

  Fly   171 DRFQLTVWGTTAEDFRSIPRVLK------HSVGDRI-DRELCTLKFQQQVDESQICVHT--ETSH 226
               ::..||.|.        |||      ..|..|: |.:.|: .|:......|:||..  :|..
Human   145 ---RVAGWGRTG--------VLKPGSDTLQEVKLRLMDPQACS-HFRDFDHNLQLCVGNPRKTKS 197

  Fly   227 ACKGDSGGPFSAKILYGGTYRTFQFGIIIFGLSSCAGLSVCTNVTFYMDWI 277
            |.|||||||    :|..|..:    ||:.:|.|.....:|.|.::.|..||
Human   198 AFKGDSGGP----LLCAGVAQ----GIVSYGRSDAKPPAVFTRISHYRPWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 64/244 (26%)
Tryp_SPc 57..277 CDD:238113 64/244 (26%)
CMA1NP_001827.1 Tryp_SPc 22..243 CDD:238113 66/246 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.