DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and Gzmbl3

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001316809.1 Gene:Gzmbl3 / 120766154 RGDID:2320502 Length:248 Species:Rattus norvegicus


Alignment Length:223 Identity:53/223 - (23%)
Similarity:94/223 - (42%) Gaps:28/223 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 NGKAKCSGSLINHRFVLTAAHCVFREAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHA 129
            :|...|.|.||...||||||||: ...:.|.||       ..|.....::...  :.:.|.|.|.
  Rat    45 SGSTMCGGFLIQEDFVLTAAHCL-GSKITVTLG-------AHNIKEQEKMQQV--IPVVKIIPHP 99

  Fly   130 GFGKIQAQQY--DIGLLRMQHAVQYSDFVRPICL-LINEPVAAIDRFQLTVWGTTAEDFRSIPRV 191
            .:   .:::|  ||.||:::...:.:..|:.:.| ..|..|...|...:..||......:...::
  Rat   100 AY---NSKKYSNDIMLLKLKSKAKRTRAVKTLSLPRSNFKVKPGDVCNVAGWGKLGPMGKFPDKL 161

  Fly   192 LKHSVGDRIDRELCTLKFQQQVDE-SQICVHTETSHACK--GDSGGPFSAKILYGGTYRTFQFGI 253
            .:..:..:.|:| |...|::..:: :|||..........  ||||||...|.:..        ||
  Rat   162 QEVELTVQEDQE-CETYFKKAYNKANQICAGDPKIKRASFGGDSGGPLVCKKVAA--------GI 217

  Fly   254 IIFGLSSCAGLSVCTNVTFYMDWIWDAL 281
            :.:|..:.:.....|.|:.::.||.:.:
  Rat   218 VAYGSKNGSAPEAFTKVSTFLSWIKETM 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 51/217 (24%)
Tryp_SPc 57..277 CDD:238113 51/217 (24%)
Gzmbl3NP_001316809.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.