DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and AgaP_AGAP012946

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_003436544.1 Gene:AgaP_AGAP012946 / 11175517 VectorBaseID:AGAP012946 Length:318 Species:Anopheles gambiae


Alignment Length:235 Identity:60/235 - (25%)
Similarity:107/235 - (45%) Gaps:49/235 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 KCSGSLINHRFVLTAAHC-VFREAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAGFG 132
            :|.|:||:.:.:|||||| .:.:.:.|.:|::|         :.....:.|...|.....|..:.
Mosquito   101 RCGGTLISDQHILTAAHCFAYGDPVIVRVGEYD---------TELETDDEYDSDIASIRRHPNYS 156

  Fly   133 KIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAIDRFQLT------VWGTTAE-------- 183
            .:::.. ||.|::::|.:..|..:||.||...|...: .|:..|      .:|||..        
Mosquito   157 NLRSYD-DIALVKLKHPIVLSKHIRPACLWETEERNS-TRYIATGFGYNETYGTTLSTVMMKVNL 219

  Fly   184 DFRSIPRVLKHSVGDRIDRELCTLKFQQQVDESQICVHT--ETSHACKGDSGGPFSAKILYGGTY 246
            |...:....::..|||        :|:|.|.:.|:||.:  |....|:||||||.....    ..
Mosquito   220 DEFPVSDCERNFKGDR--------RFKQGVRDGQLCVGSIVEGRDTCQGDSGGPLQVVT----NT 272

  Fly   247 RTFQFGIIIFGLSSCAGL-------SVCTNVTFYMDWIWD 279
            ::..:|::  |::|..|:       ::.|.|:.|:|||.|
Mosquito   273 KSCSYGVV--GITSVGGVCGIGNAKAIYTKVSHYIDWIED 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 57/231 (25%)
Tryp_SPc 57..277 CDD:238113 57/231 (25%)
AgaP_AGAP012946XP_003436544.1 Tryp_SPc 69..311 CDD:238113 60/235 (26%)
Tryp_SPc 69..308 CDD:214473 57/231 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.