DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and LOC108647852

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_017950296.2 Gene:LOC108647852 / 108647852 -ID:- Length:416 Species:Xenopus tropicalis


Alignment Length:309 Identity:80/309 - (25%)
Similarity:129/309 - (41%) Gaps:64/309 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VIAALLILFASLFLGSREGSAFLLDAECG-RSLPTNAKLTWWNYFDSSTDIQAN-------PWIV 60
            |:.....:|.|.|:...|.|..   ..|| |.|..       |:......|:.|       ||:.
 Frog     5 VLLLSFFIFISFFISFSENSIL---KTCGIRPLVK-------NHHRVRRVIEGNTPEPGSWPWMA 59

  Fly    61 SVIVNGK----AKCSGSLINHRFVLTAAHCV-----FREAMQVHLGDFDAWNPGQNCSSGARLSN 116
            |:.:..|    :.|.|.|:::|:|:|||||:     :|...::.||..|....|....       
 Frog    60 SIQLLYKDGYGSACGGVLLSNRWVVTAAHCLSDLKRYRHLARIVLGARDLTQLGPETQ------- 117

  Fly   117 AYCVRIDKK-IVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEP----VAAIDRFQLT 176
               :|..|: |.|..|.. :..:.||.|:|:.:.|::||:::|.||   .|    |..:|...:.
 Frog   118 ---IRTIKQWIQHEDFDH-KTHKNDIALIRLNYPVKFSDYIQPACL---PPKSSNVYKMDDCHIA 175

  Fly   177 VWGTTAEDFRSIPRVLKHSVGDRIDRELCTLK--FQQQVDESQICVHTETS--HACKGDSGGPFS 237
            .||...|..|::..:|:.:..:.|||:.|...  :...:.:..:|...|..  ..|.||||||..
 Frog   176 GWGLLNEKPRTVTTMLQEATVELIDRKRCNSSDWYNGGIHDDNLCAGYEQGGPDVCMGDSGGPLM 240

  Fly   238 AKILYGGTYRTFQFGIIIFGLSSCAGL-------SVCTNVTFYMDWIWD 279
            .|....|.|       .:.|:.|..||       .|.|:|..:..||::
 Frog   241 CKRKKAGIY-------YVVGIVSWGGLCGQPHSNGVYTSVQDFEQWIFN 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 65/244 (27%)
Tryp_SPc 57..277 CDD:238113 65/244 (27%)
LOC108647852XP_017950296.2 Tryp_SPc 44..280 CDD:238113 67/256 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.