DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:239 Identity:67/239 - (28%)
Similarity:101/239 - (42%) Gaps:39/239 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PWIVSVIVNGKAKCSGSLINHRFVLTAAHCVFREA----MQVHLGDFDAWNPGQNCSSGARLSNA 117
            ||..|:.......|.|||||..:||:||||...:.    :.|.||.     ..||....:|:|  
Zfish   320 PWQASLYWYSGQTCGGSLINKEWVLSAAHCFNGQRNGFYLTVILGP-----KTQNKYDPSRIS-- 377

  Fly   118 YCVRIDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAIDRFQLTVWGTTA 182
               |..|.::...:........||.|:|:...:.::|.:||:||.....|...|   ...|.|| 
Zfish   378 ---RSVKAVIKHPYYNPNTNDNDIALVRLSFPITFTDSIRPVCLAAEGSVFNSD---TESWITT- 435

  Fly   183 EDFRSI--------PRVLKHSVGDRIDRELCTLKF-QQQVDESQIC--VHTETSHACKGDSGGPF 236
              :|:|        |::.:......|....|...: ...:.::.||  :..|....|:|||||| 
Zfish   436 --WRNISDGVPLPSPKIFQEVEVPVIGNRQCNCLYGVGSITDNMICAGLLKEGKDLCQGDSGGP- 497

  Fly   237 SAKILYGGTYRTFQFGIIIFGLSSCAGL---SVCTNVTFYMDWI 277
               ::...:....|.||:.|| |.||..   .|.|.|:.|.:||
Zfish   498 ---MVSNQSSVWVQSGIVSFG-SGCAQSEFPGVYTRVSRYQEWI 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 65/237 (27%)
Tryp_SPc 57..277 CDD:238113 65/237 (27%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035
Tryp_SPc 309..537 CDD:238113 65/237 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.