DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and LOC103908930

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001373362.1 Gene:LOC103908930 / 103908930 -ID:- Length:243 Species:Danio rerio


Alignment Length:315 Identity:69/315 - (21%)
Similarity:118/315 - (37%) Gaps:105/315 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKKVIAALLILFASLFLGSREGSAFLLDAEC--------GRSLPTNAKLTWWNYFDSSTDIQANP 57
            ||.|:.|||:                ::..|        |...|.|::                |
Zfish     1 MKTVVFALLV----------------VNVACSPVDKIIGGYECPPNSQ----------------P 33

  Fly    58 WIVSVIVNGKAKCSGSLINHRFVLTAAHCVFREAMQVHLGDFDAWNPGQNCSSGARLSNAYC--- 119
            |.:.:..:|:..|..||||..:.::|||                      |:.||.|...|.   
Zfish    34 WQIYITNDGQRWCGASLINESWAVSAAH----------------------CNIGANLLTVYLGKH 76

  Fly   120 -----------VRIDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAI--- 170
                       :|.:|...|..| |..::..||.|::::....::.:|:||      |:|..   
Zfish    77 NIDVVEKTEQRIRTEKVFPHPEF-KFPSEDNDIMLIKLKDPAVFNQYVQPI------PLATSCSS 134

  Fly   171 --DRFQLTVWGTTAEDFRSIPRVLKHSVGDRIDRELCTLKFQQQVDESQICV--HTETSHACKGD 231
              ::..::.||.|.....|:.:.|..:|.   .|:.|...::.:..::.:|.  .......|.||
Zfish   135 EGEQCLVSGWGYTEVGLPSVLQCLDLAVQ---SRQECERVYKDKFTQNMLCAGFMEGGKGVCHGD 196

  Fly   232 SGGPFSAKILYGGTYRTFQFGIIIFGLSSCA--GL-SVCTNVTFYMDWIWDALVN 283
            ||||    ::..|..|    |::.:| :.||  |. :|...|..|.|||...:.|
Zfish   197 SGGP----LVCNGELR----GVVSWG-AGCAEPGYPAVYVEVCRYSDWIATTIAN 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 56/243 (23%)
Tryp_SPc 57..277 CDD:238113 56/243 (23%)
LOC103908930NP_001373362.1 Tryp_SPc 21..239 CDD:238113 61/274 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.