DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and plaub

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001239279.1 Gene:plaub / 100538108 ZFINID:ZDB-GENE-030619-15 Length:432 Species:Danio rerio


Alignment Length:262 Identity:71/262 - (27%)
Similarity:118/262 - (45%) Gaps:46/262 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 IQANPWIVSVIVNGKAK-----CSGSLINHRFVLTAAHCVFREAMQ--VH-----LGDFDAWNPG 105
            ::.:|| ::.|.:.|::     |.||||:..::|||||| |.:..|  ||     |        |
Zfish   188 LERHPW-MAAIYSRKSRGRFFTCGGSLISPCWILTAAHC-FPDGAQTLVHKLSVVL--------G 242

  Fly   106 QNCSSGARLSNAYCVRIDKKIVHAGFGKIQAQ-QYDIGLLRMQ----HAVQYSDFVRPICLLINE 165
            :...:...:.:....|:.:..:|..|...... ..||.||:::    ...:.|..|:.:|  |..
Zfish   243 KKAINETDVQSEQEFRVSELFIHEHFDNTDGNFNNDIALLKIRGPDGRCAKESSSVKTVC--IPG 305

  Fly   166 P-VAAIDRFQLTVWGTTAEDFRS--IPRVLKHSVGDRIDRELCTLK--FQQQVDESQICVHTE-- 223
            | |:..|....||.|...|...|  ..:.||.:....:.::||:.|  :...:.|:.:|..:.  
Zfish   306 PNVSLSDGTSCTVTGYGREHEGSWFYSQYLKEAQVKILSQDLCSSKEYYGNMITENMLCAGSPDW 370

  Fly   224 TSHACKGDSGGPFSAKILYGGTYRTFQFGIIIFGLSSCAGL---SVCTNVTFYMDWIWD--ALVN 283
            :|.|||||||||...::    ..|.|.||::.:| ..|:..   .|...|:.|..||.:  .|.:
Zfish   371 SSDACKGDSGGPLVCRV----QDRVFLFGVVSWG-EGCSRAFRPGVYAKVSNYYHWILEKSGLTS 430

  Fly   284 LS 285
            ||
Zfish   431 LS 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 66/246 (27%)
Tryp_SPc 57..277 CDD:238113 66/246 (27%)
plaubNP_001239279.1 KR 74..151 CDD:294073
Tryp_SPc 179..422 CDD:214473 66/250 (26%)
Tryp_SPc 180..422 CDD:238113 66/250 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.