DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and si:ch73-182e20.4

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_009296334.2 Gene:si:ch73-182e20.4 / 100535157 ZFINID:ZDB-GENE-131127-155 Length:341 Species:Danio rerio


Alignment Length:282 Identity:82/282 - (29%)
Similarity:115/282 - (40%) Gaps:59/282 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CGRSLP-TNAKLTWWNYFDSSTDIQANPWIVSVIVNGKAKCSGSLINHRFVLTAAHCV--FREAM 92
            |||..| .|.::....   :||: .|.||:||:...|...|.|||||:.:||||||||  .|..|
Zfish    60 CGRPNPQLNPRIVGGL---NSTE-GAWPWMVSLRYYGNHICGGSLINNEWVLTAAHCVNLTRSNM 120

  Fly    93 QVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVR 157
            .|:||.:..:         |...|.....:...|.|..:.. .....||.||::...|.|||:::
Zfish   121 LVYLGKWRRY---------AADVNEITRTVSNIIPHPSYNS-TTYDNDIALLQLSSTVHYSDYIK 175

  Fly   158 PICLL---INEPVAAIDRFQLTVWG-------------TTAEDFRSIP-------RVLKHSVGDR 199
            |:||.   .|.|...  |...|.||             ||.    |:|       :.:|..|...
Zfish   176 PVCLADEQSNFPPGT--RSWATGWGRIGVSGKGGIRGRTTV----SVPLPPPGILQEVKLKVYSN 234

  Fly   200 IDRELCTLKFQQQVDESQICVHTETSHAC--KGDSGGPFSAKILYGGTYRTFQFGIIIFGLSSCA 262
            .|   |......:::.:.||..|.:....  .||||||..:|    ......|.|::..|. .||
Zfish   235 AD---CNSICHGRINPNMICAGTRSGGKATFSGDSGGPLVSK----QCSVWVQAGVVSHGY-GCA 291

  Fly   263 GLS---VCTNVTFYMDWIWDAL 281
            ..:   |...|:.|..||..|:
Zfish   292 QPNLPEVFIRVSEYKQWITAAV 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 71/249 (29%)
Tryp_SPc 57..277 CDD:238113 71/249 (29%)
si:ch73-182e20.4XP_009296334.2 Tryp_SPc 71..309 CDD:238113 74/265 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.