DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and tmprss13

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_002932950.2 Gene:tmprss13 / 100491822 XenbaseID:XB-GENE-940757 Length:462 Species:Xenopus tropicalis


Alignment Length:284 Identity:64/284 - (22%)
Similarity:121/284 - (42%) Gaps:78/284 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ECGRSLP------TNAKLTWWNYFDSSTDIQANPWIVSVIVNGKAK----CSGSLINHRFVLTAA 84
            :||:.:.      .:|||  .:|          ||.||:......:    |.|::||:::|.||.
 Frog   213 DCGKRMANRIIGGVSAKL--GDY----------PWQVSLHQRAGNRFAHVCGGTIINNKWVATAT 265

  Fly    85 HCVFREAM-----QVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAGFGKIQAQQYDIGLL 144
            || |:|.:     :|:.|..:..|          |:..:.|.:   ||...........:|:.|:
 Frog   266 HC-FQETVDPANWRVYAGIINQHN----------LNAMHTVTV---IVRNENYNSDTDDFDMALM 316

  Fly   145 RMQHAVQYSDFVRPICL-LINEPVAAIDRFQLTVWGTTAED--------FRSIPRVLKHSVGDRI 200
            :|:....::..::|.|| ::|:.....|...::.:|.|.:.        .::...|:..||.:::
 Frog   317 KMKQPFIFTAAIQPACLPMMNQNFGQNDICFISGFGKTIQSSDEGSQYLMQAQVHVIPTSVCNKV 381

  Fly   201 D--------RELCTLKFQQQVDESQICVHTETSHACKGDSGGPFSAKILYGGTYRTFQFGIIIFG 257
            :        |.:|....|.|:|            :|:||||||...:  .||.:  :..|:..:|
 Frog   382 NVYNGAITPRMMCAGYLQGQID------------SCQGDSGGPLVCQ--QGGIW--YLAGVTSWG 430

  Fly   258 LSSCAGLS---VCTNVTFYMDWIW 278
             |.|...:   |.:||..::.||:
 Frog   431 -SGCGQANKPGVYSNVNAFLQWIY 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 56/248 (23%)
Tryp_SPc 57..277 CDD:238113 56/248 (23%)
tmprss13XP_002932950.2 SRCR_2 128..217 CDD:382996 2/3 (67%)
Tryp_SPc 222..455 CDD:238113 62/275 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.