DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and LOC100490440

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_002939183.3 Gene:LOC100490440 / 100490440 -ID:- Length:565 Species:Xenopus tropicalis


Alignment Length:220 Identity:43/220 - (19%)
Similarity:72/220 - (32%) Gaps:75/220 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 KCSGSLINHRFVLTAAHC--------VFREAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKK 125
            |.:..|:..|.:    ||        |.||..::.:|.:|                 .|:.:..|
 Frog   384 KGAPQLVRERLL----HCLPSIVAQLVRREQRRIMMGVYD-----------------LCLDVCTK 427

  Fly   126 IVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAIDRFQLTVWGTTAEDFRSIPR 190
               |.:|:|......:.                         ||:..|: :.:|...|....|.:
 Frog   428 ---ASYGQIPQALASLS-------------------------AALSSFR-SRFGLDEESISRIAQ 463

  Fly   191 VLKHSVGDRIDRELCTLKFQQQVDESQICVHTETSHACKGDSGGPFSAKILYGGT--------YR 247
            |...|..|......|.|...|.:::.|..|....|.     |...:|...::|||        .|
 Frog   464 VTGCSADDLHSEIHCPLALPQSIEQLQQMVSQPLSL-----SEIVWSYIPIWGGTETAPTLSVER 523

  Fly   248 TFQFGI-IIFGLSSCAG---LSVCT 268
            |::..: .:||::..|.   |..||
 Frog   524 TYRLLVESVFGMAQDAERVLLRGCT 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 43/220 (20%)
Tryp_SPc 57..277 CDD:238113 43/220 (20%)
LOC100490440XP_002939183.3 P-loop_NTPase 32..218 CDD:422963
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.