DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and tmprss9

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_002940084.3 Gene:tmprss9 / 100489279 XenbaseID:XB-GENE-993973 Length:1151 Species:Xenopus tropicalis


Alignment Length:242 Identity:66/242 - (27%)
Similarity:114/242 - (47%) Gaps:39/242 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PWIVSVIVNGKAKCSGSLINHRFVLTAAHCVFR---EAMQVHLGDFDAWNPGQNCSSGARLSNAY 118
            ||..|:....:..|..::|..|::::||||..:   :.:..|:        |....|||   :..
 Frog   559 PWQASLKEGSRHFCGATIIGDRWLVSAAHCFNQTKVDQVTAHM--------GSTALSGA---DTI 612

  Fly   119 CVRIDKK--IVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAIDRF------QL 175
            .::|..|  |.|..|..: ...:|:.:|.:..::.::.:|:|:||     .:|:.:|      .:
 Frog   613 AIKISLKRVIQHPHFNPL-TLDFDVAVLELASSLTFNKYVQPVCL-----PSALQKFPAGWKCMI 671

  Fly   176 TVWGTTAEDFRSIPRVL-KHSVGDRIDRELCTLKFQQQVDESQICVH--TETSHACKGDSGGPFS 237
            :.||...|...|.|.|| |.||| .||:::|::.:...:.|..||..  .....:|:||||||.:
 Frog   672 SGWGNIKEGNVSKPEVLQKASVG-IIDQKICSVLYNFSITERMICAGFLDGKVDSCQGDSGGPLA 735

  Fly   238 AKILYGGTYRTFQFGIIIFGLSSCAGL---SVCTNVTFYMDWIWDAL 281
            .:...|   ..|..||:.:|: .||..   .|.:.||...|||.|.:
 Frog   736 CEESPG---IFFLAGIVSWGI-GCAQAKKPGVYSRVTKLKDWILDTV 778

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 63/236 (27%)
Tryp_SPc 57..277 CDD:238113 63/236 (27%)
tmprss9XP_002940084.3 SEA 60..156 CDD:396113
LDLa 186..221 CDD:238060
Tryp_SPc 234..463 CDD:214473
Tryp_SPc 547..774 CDD:238113 63/236 (27%)
LDLa 871..906 CDD:238060
Tryp_SPc 919..1145 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.