DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and f7l

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001083027.2 Gene:f7l / 100038778 ZFINID:ZDB-GENE-070424-102 Length:431 Species:Danio rerio


Alignment Length:240 Identity:61/240 - (25%)
Similarity:106/240 - (44%) Gaps:41/240 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PWIVSVIVNGKAKCSGSLINHRFVLTAAHCVFRE---AMQV----HLGDFDAWNPGQNCSSGARL 114
            ||...:..:|:.||.|.::|.::::|||||::|:   .:||    |:.|.|.......       
Zfish   207 PWQALLEYDGQYKCGGVILNSQWIITAAHCIWRKDPALLQVIVGEHIRDRDEGTEQMR------- 264

  Fly   115 SNAYCVRIDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICL-----LINEPVAAIDRFQ 174
                  ::.:..:|..:.. .:...|:.|||:...|....:..|:||     ..:..:|:|....
Zfish   265 ------KVSEVFLHPQYNH-SSTDSDVALLRLHRPVTLGPYALPVCLPPPNGTFSRTLASIRMST 322

  Fly   175 LTVWGTTAEDFRSIP--RVLKHSVGDRIDRELCTLKFQQQVDESQICVHTETS--HACKGDSGGP 235
            ::.||..|:   |.|  .||:.....|:..|.|..:....|..:.:|......  .:|:||||||
Zfish   323 VSGWGRLAQ---SGPPSTVLQRLQVPRVSSEDCRARSGLTVSRNMLCAGFAEGGRDSCQGDSGGP 384

  Fly   236 FSAKILYGGTYRTFQFGIIIFGLSSCAGLSV---CTNVTFYMDWI 277
            ...:  |..|:  |..||:.:| ..||...|   .|.|:.:::||
Zfish   385 LVTR--YRNTW--FLTGIVSWG-KGCARADVYGIYTRVSVFVEWI 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 59/238 (25%)
Tryp_SPc 57..277 CDD:238113 59/238 (25%)
f7lNP_001083027.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.