DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and emx2

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001128284.1 Gene:emx2 / 100038069 XenbaseID:XB-GENE-481028 Length:247 Species:Xenopus tropicalis


Alignment Length:100 Identity:19/100 - (19%)
Similarity:32/100 - (32%) Gaps:41/100 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PWIVSVIVNGKAKCSGSLINHRFVLTAAHCVFREAMQVHLGDFDAWNPGQNCSSGARLSNAYCVR 121
            ||::.         ....:.|||                        .|.:.|:.:.|.:....|
 Frog   116 PWLIH---------RYRYLGHRF------------------------QGNDTSAESFLLHNALAR 147

  Fly   122 IDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFV 156
            ..|:| ...|...|       |||::||.:.:.:|
 Frog   148 KPKRI-RTAFSPSQ-------LLRLEHAFEKNHYV 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 18/99 (18%)
Tryp_SPc 57..277 CDD:238113 18/99 (18%)
emx2NP_001128284.1 Homeobox 153..206 CDD:365835 7/28 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.