DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubqn and OASL

DIOPT Version :9

Sequence 1:NP_001285457.1 Gene:Ubqn / 32977 FlyBaseID:FBgn0031057 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_003724.1 Gene:OASL / 8638 HGNCID:8090 Length:514 Species:Homo sapiens


Alignment Length:127 Identity:29/127 - (22%)
Similarity:51/127 - (40%) Gaps:46/127 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DSGIKDFKILVAQKFEAEPEQLV---LIFAGKIMKDTDTLQMHNIKDNLTVHLV----IKAPTRN 84
            |.|::|.::          ||.|   |:|         |:|.....:.:||.:|    ...|:..
Human   120 DLGLEDLRM----------EQRVPDALVF---------TIQTRGTAEPITVTIVPAYRALGPSLP 165

  Fly    85 NEQPARQPADVRQTPFGLNQFGGLAGMEALGAGSN---TFMDLQARMQNELLNNGDMLRSLM 143
            |.||   |.:|.           ::.::|.|...|   :|.:||   :|.:.:....|:||:
Human   166 NSQP---PPEVY-----------VSLIKACGGPGNFCPSFSELQ---RNFVKHRPTKLKSLL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbqnNP_001285457.1 UBQ 9..79 CDD:214563 13/58 (22%)
hPLIC_N 9..79 CDD:176403 13/58 (22%)
STI1 322..368 CDD:128966
UBA_PLICs 501..537 CDD:270582
OASLNP_003724.1 NT_2-5OAS_ClassI-CCAase 29..212 CDD:143390 29/127 (23%)
OAS1_C 168..351 CDD:313619 14/60 (23%)
OASL_repeat1 354..433 CDD:176406
ubiquitin 436..506 CDD:306702
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.