DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubqn and UBI4

DIOPT Version :10

Sequence 1:NP_608344.1 Gene:Ubqn / 32977 FlyBaseID:FBgn0031057 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_013061.1 Gene:UBI4 / 850620 SGDID:S000003962 Length:381 Species:Saccharomyces cerevisiae


Alignment Length:77 Identity:29/77 - (37%)
Similarity:43/77 - (55%) Gaps:4/77 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GGSKRINVVVKTPKDKK-TVEVDEDSGIKDFKILVAQKFEAEPEQLVLIFAGKIMKDTDTLQMHN 67
            ||   :.:.|||...|. |:||:....|.:.|..:..|....|:|..||||||.::|..||..:|
Yeast    75 GG---MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

  Fly    68 IKDNLTVHLVIK 79
            |:...|:|||::
Yeast   137 IQKESTLHLVLR 148

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
UbqnNP_608344.1 Ubl_PLICs 7..79 CDD:340506 27/72 (38%)
PABP-1234 <233..409 CDD:130689
UBA_PLICs 501..537 CDD:270582