DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubqn and AT1G53930

DIOPT Version :10

Sequence 1:NP_608344.1 Gene:Ubqn / 32977 FlyBaseID:FBgn0031057 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_175796.1 Gene:AT1G53930 / 841831 AraportID:AT1G53930 Length:158 Species:Arabidopsis thaliana


Alignment Length:68 Identity:21/68 - (30%)
Similarity:38/68 - (55%) Gaps:1/68 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VVVKTPKDKKTV-EVDEDSGIKDFKILVAQKFEAEPEQLVLIFAGKIMKDTDTLQMHNIKDNLTV 74
            :.:||...::.| ||:....|::.|..:..|.....:|..|||.||.::|..||..:||:::..:
plant    88 IFIKTLTGRRIVLEVENCDTIENIKAKIQDKQGIPVDQQRLIFKGKQLEDGLTLADYNIQNDSIL 152

  Fly    75 HLV 77
            ||:
plant   153 HLI 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbqnNP_608344.1 Ubl_PLICs 7..79 CDD:340506 21/68 (31%)
PABP-1234 <233..409 CDD:130689
UBA_PLICs 501..537 CDD:270582
AT1G53930NP_175796.1 Ubl1_cv_Nsp3_N-like 86..158 CDD:475130 21/68 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.